Showing 1 - 3 results out of 3 with the query:
AB_1079840
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-RPL27 antibody produced in rabbit
Human RPL27 human
Sigma-Aldrich
HPA002649
(Sigma-Aldrich Cat# HPA002649, RRID:AB_1079840)
unknown
rabbit
Vendor recommendations:
Anti-RPL27 polyclonal antibody
RPL27 See NCBI gene human, rat, mouse
Atlas Antibodies Go To Vendor
HPA002649
(Atlas Antibodies Cat# HPA002649, RRID:AB_1079840)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GKVVLVLAGRYSGRKAVIVKNIDDGTSDRPYSHALVAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDPALKRKARREAKVKFEERYKTGKN; Manufacturer approved use: IHC, WB
Anti-RPL27 antibody produced in rabbit
RPL27 antibody produced in rabbit human, human
Sigma-Aldrich
HPA002649
(Sigma-Aldrich Cat# HPA002649, RRID:AB_1079840)
polyclonal antibody
rabbit
Vendor recommendations: Immunofluorescence; Immunohistochemistry; Western Blot; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable