Showing 1 - 3 results out of 3 with the query:
AB_1080017
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-SLC9A3R2 antibody produced in rabbit
Human SLC9A3R2 human
Sigma-Aldrich
HPA001672
(Sigma-Aldrich Cat# HPA001672, RRID:AB_1080017)
unknown
rabbit
Vendor recommendations:
Anti-SLC9A3R2 antibody produced in rabbit
SLC9A3R2 antibody produced in rabbit human, human
Sigma-Aldrich
HPA001672
(Sigma-Aldrich Cat# HPA001672, RRID:AB_1080017)
polyclonal antibody
rabbit
Vendor recommendations: Other; Immunohistochemistry; Immunofluorescence; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Anti-SLC9A3R2 polyclonal antibody
SLC9A3R2 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA001672
(Atlas Antibodies Cat# HPA001672, RRID:AB_1080017)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLH; Manufacturer approved use: IHC