Showing 1 - 3 results out of 3 with the query:
AB_1080021
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Rabbit Anti-Human SLMAP Prestige Antibodies??? Powered by Atlas Antibodies Antibody, Unconjugated
Human SLMAP human
Sigma-Aldrich
HPA002358
(Sigma-Aldrich Cat# HPA002358, RRID:AB_1080021)
unknown
rabbit
Vendor recommendations:
Anti-SLMAP antibody produced in rabbit
SLMAP antibody produced in rabbit human
Sigma-Aldrich
HPA002358
(Sigma-Aldrich Cat# HPA002358, RRID:AB_1080021)
polyclonal antibody
rabbit
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Other; Western Blot
Anti-SLMAP polyclonal antibody
SLMAP See NCBI gene human, rat
Atlas Antibodies Go To Vendor
HPA002358
(Atlas Antibodies Cat# HPA002358, RRID:AB_1080021)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQ; Manufacturer approved use: IHC, WB