Showing 1 - 3 results out of 3 with the query:
AB_1080489
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Rabbit Anti-Human HUWE1 Prestige Antibodies??? Powered by Atlas Antibodies Antibody, Unconjugated
Human HUWE1 human
Sigma-Aldrich
HPA002548
(Sigma-Aldrich Cat# HPA002548, RRID:AB_1080489)
unknown
rabbit
Vendor recommendations:
Anti-HUWE1 antibody produced in rabbit
HUWE1 antibody produced in rabbit human
Sigma-Aldrich
HPA002548
(Sigma-Aldrich Cat# HPA002548, RRID:AB_1080489)
polyclonal antibody
rabbit
Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Anti-HUWE1 polyclonal antibody
HUWE1 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA002548
(Atlas Antibodies Cat# HPA002548, RRID:AB_1080489)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SGSSTTRLTQGIGRSQRTLRQLTANTGHTIHVHYPGNRQPNPPLILQRLLGPSAAADILQLSSSLPLQSRGRARLLVGNDDVHIIARSDDELLDDFFHDQSTATSQAGTLSSIPTALTRWTEECKVLDAESMHDCVSVVKVSIVNHLE; Manufacturer approved use: ICC-IF, IHC