Showing 1 - 3 results out of 3 with the query:
AB_10969629
Antibody ID
Antibody Name
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-MRPL15 antibody produced in rabbit
MRPL15 antibody produced in rabbit human, human
Sigma-Aldrich
HPA044425
(Sigma-Aldrich Cat# HPA044425, RRID:AB_10969629)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
639af6db-b1db-5d15-81ff-3c57df12fcd1
Anti-MRPL15 polyclonal antibody
MRPL15 See NCBI gene human, rat, mouse
Atlas Antibodies Go To Vendor
HPA044425
(Atlas Antibodies Cat# HPA044425, RRID:AB_10969629)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LRGQPIPKRMLPPEELVPYYTDAKNRGYLADPAKFPEARLELARKYGYILPDITKDELFKMLCTRKDPRQIFFGLAPGWVVNMADKKILKPTDEN; Manufacturer approved use: IHC, WB
405a33ff-bbc7-511b-977c-7c4d562209c2
Anti-MRPL15 antibody produced in rabbit
MRPL15 antibody produced in rabbit human
Sigma-Aldrich
HPA044425
(Sigma-Aldrich Cat# HPA044425, RRID:AB_10969629)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
f0afa41a-235c-548f-9418-0751a2969e43