Showing 1 - 3 results out of 3 with the query:
AB_1844479
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-ACADVL antibody produced in rabbit
Human ACADVL human
Sigma-Aldrich
HPA020595
(Sigma-Aldrich Cat# HPA020595, RRID:AB_1844479)
unknown
rabbit
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
792b0d89-cb6e-5c1a-9ed3-2b27318930e9
Anti-ACADVL polyclonal antibody
ACADVL See NCBI gene human
Atlas Antibodies Go To Vendor
HPA020595
(Atlas Antibodies Cat# HPA020595, RRID:AB_1844479)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VFFDGVRVPSENVLGEVGSGFKVAMHILNNGRFGMAAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQI; Manufacturer approved use: IHC, WB
33c6745f-f0da-5fbc-8568-ba6b105bc1bb
Anti-ACADVL antibody produced in rabbit
ACADVL antibody produced in rabbit human, human
Sigma-Aldrich
HPA020595
(Sigma-Aldrich Cat# HPA020595, RRID:AB_1844479)
polyclonal antibody
rabbit
Vendor recommendations: Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
b93ae3c8-90d8-57dc-a749-e7ae411c1397