Showing 1 - 3 results out of 3 with the query:
AB_1844682
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-AK5 antibody produced in rabbit
Human AK5 human
Sigma-Aldrich
HPA019128
(Sigma-Aldrich Cat# HPA019128, RRID:AB_1844682)
unknown
rabbit
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
5885fbdc-272a-5b63-b559-893a2ea2a71d
Anti-AK5 polyclonal antibody
AK5 See NCBI gene human
Atlas Antibodies
HPA019128
(Atlas Antibodies Cat# HPA019128, RRID:AB_1844682)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KLFPNKEAAAGSSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVE; Manufacturer approved use: ICC-IF, IHC, WB
2b9ae658-0efd-570d-89ee-7bf61706922a
Anti-AK5 antibody produced in rabbit
AK5 antibody produced in rabbit human, human
Sigma-Aldrich
HPA019128
(Sigma-Aldrich Cat# HPA019128, RRID:AB_1844682)
polyclonal antibody
rabbit
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
1c001ba8-c16f-557c-bfd5-7a26a0ca0b89