Showing 1 - 3 results out of 3 with the query:
AB_1844724
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-ALDH1B1 antibody produced in rabbit
Human ALDH1B1 human
Sigma-Aldrich
HPA021037
(Sigma-Aldrich Cat# HPA021037, RRID:AB_1844724)
unknown
rabbit
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
4cbb3fa5-94db-511a-b4f9-ae81b6294315
Anti-ALDH1B1 polyclonal antibody
ALDH1B1 See NCBI gene human
Atlas Antibodies
HPA021037
(Atlas Antibodies Cat# HPA021037, RRID:AB_1844724)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHV; Manufacturer approved use: ICC-IF, IHC, WB
3b9ce883-43d0-5b51-a821-a0136b8b53e3
Anti-ALDH1B1 antibody produced in rabbit
ALDH1B1 antibody produced in rabbit human, human
Sigma-Aldrich
HPA021037
(Sigma-Aldrich Cat# HPA021037, RRID:AB_1844724)
polyclonal antibody
rabbit
Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot; Immunofluorescence
1097b4f3-a0d9-5d0d-984d-238fa61266c3