Showing 1 - 3 results out of 3 with the query:
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Clone ID
Host Organism
Anti-BCAR3 antibody produced in rabbit
Human BCAR3 human
(Sigma-Aldrich Cat# HPA014858, RRID:AB_1845302)
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Anti-BCAR3 antibody produced in rabbit
BCAR3 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA014858, RRID:AB_1845302)
polyclonal antibody
Vendor recommendations: Immunofluorescence; Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Anti-BCAR3 polyclonal antibody
BCAR3 See NCBI gene human
Atlas Antibodies Go To Vendor
(Atlas Antibodies Cat# HPA014858, RRID:AB_1845302)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SPLAEHRPDAYQDVSIHGTLPRKKKGPPPIRSCDDFSHMGTLPHSKSPRQNSPVTQDGIQESPWQDRHGETFTFRDPHLLDPTVEYVKFSKERHIMDRTPEKLKKEL; Manufacturer approved use: ICC-IF, IHC, WB