Showing 1 - 3 results out of 3 with the query:
AB_1845402
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-BNC2 antibody produced in rabbit
Human BNC2 human
Sigma-Aldrich
HPA018525
(Sigma-Aldrich Cat# HPA018525, RRID:AB_1845402)
unknown
rabbit
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
8184a691-c780-5958-abed-2b119f0c625f
Anti-BNC2 antibody produced in rabbit
BNC2 antibody produced in rabbit human, human
Sigma-Aldrich
HPA018525
(Sigma-Aldrich Cat# HPA018525, RRID:AB_1845402)
polyclonal antibody
rabbit
Vendor recommendations: Immunofluorescence; Immunohistochemistry; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
dfba9cb8-0fc6-53a0-83be-391665b52c85
Anti-BNC2 polyclonal antibody
BNC2 See NCBI gene human
Atlas Antibodies
HPA018525
(Atlas Antibodies Cat# HPA018525, RRID:AB_1845402)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YENESESSEPKLGEESMEGDEHIHSEVSEKVLMNSERPDENHSEPSHQDVIKVKEEFTDPTYDMFYMSQYGLYNGGGASMAALHESFTSSLNYGSPQKFSPEGDLCSSPDPKICYVCKKSFKSSYSVK; Manufacturer approved use: ICC-IF, IHC
cdf1108a-bd6b-5848-8b8e-e22a50ff695f