Showing 1 - 3 results out of 3 with the query:
AB_1845803
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-C9orf123 antibody produced in rabbit
Human C9orf123 human
Sigma-Aldrich
HPA014585
(Sigma-Aldrich Cat# HPA014585, RRID:AB_1845803)
unknown
rabbit
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Anti-C9orf123 antibody produced in rabbit
C9orf123 antibody produced in rabbit human, human
Sigma-Aldrich
HPA014585
(Sigma-Aldrich Cat# HPA014585, RRID:AB_1845803)
polyclonal antibody
rabbit
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Anti-TMEM261 polyclonal antibody
TMEM261 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA014585
(Atlas Antibodies Cat# HPA014585, RRID:AB_1845803)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAPTSPAEHRLLKTCWSC; Manufacturer approved use: IHC