Showing 1 - 3 results out of 3 with the query:
AB_1845866
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-CACNB1 antibody produced in rabbit
Human CACNB1 human
Sigma-Aldrich
HPA023343
(Sigma-Aldrich Cat# HPA023343, RRID:AB_1845866)
unknown
rabbit
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
c7c44260-3406-5543-9afe-4b24f8576f5f
Anti-CACNB1 polyclonal antibody
CACNB1 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA023343
(Atlas Antibodies Cat# HPA023343, RRID:AB_1845866)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR; Manufacturer approved use: IHC
1ed3e460-674f-5ff1-b346-d3036c4fd680
Anti-CACNB1 antibody produced in rabbit
CACNB1 antibody produced in rabbit human, human
Sigma-Aldrich
HPA023343
(Sigma-Aldrich Cat# HPA023343, RRID:AB_1845866)
polyclonal antibody
rabbit
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
e22aab39-d632-51f8-97bc-3b0c8646663b