Showing 1 - 3 results out of 3 with the query:
AB_1847444
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-CYP2W1 antibody produced in rabbit
Human CYP2W1 human
Sigma-Aldrich
HPA012753
(Sigma-Aldrich Cat# HPA012753, RRID:AB_1847444)
unknown
rabbit
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Anti-CYP2W1 antibody produced in rabbit
CYP2W1 antibody produced in rabbit human, human
Sigma-Aldrich
HPA012753
(Sigma-Aldrich Cat# HPA012753, RRID:AB_1847444)
polyclonal antibody
rabbit
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Anti-CYP2W1 polyclonal antibody
CYP2W1 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA012753
(Atlas Antibodies Cat# HPA012753, RRID:AB_1847444)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VLTGFEAVKEALAGPGQELADRPPIAIFQLIQRGGGIFFSSGARWRAARQFTVRALHSLGVGREPVADKILQELKCLSGQLDGYRGRPFPLALLGWAPSNITFALLFGRRFDYRDPVFVSLLG; Manufacturer approved use: IHC, WB