Showing 1 - 3 results out of 3 with the query:
AB_1847519
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-DCT antibody produced in rabbit
Human DCT human
Sigma-Aldrich
HPA010743
(Sigma-Aldrich Cat# HPA010743, RRID:AB_1847519)
unknown
rabbit
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
9bfbb095-cbce-58a7-aa60-e7f3836d9e5d
Anti-DCT polyclonal antibody
DCT See NCBI gene human
Atlas Antibodies Go To Vendor
HPA010743
(Atlas Antibodies Cat# HPA010743, RRID:AB_1847519)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence WSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDF; Manufacturer approved use: IHC
d9837e22-c1f0-5768-a146-cc6b2d5d7e97
Anti-DCT antibody produced in rabbit
DCT antibody produced in rabbit human, human
Sigma-Aldrich
HPA010743
(Sigma-Aldrich Cat# HPA010743, RRID:AB_1847519)
polyclonal antibody
rabbit
Vendor recommendations: Immunofluorescence; Immunohistochemistry; Western Blot; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
e3b56f72-5084-58da-8314-1704ff40fb80