Showing 1 - 3 results out of 3 with the query:
AB_1849656
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-GHITM antibody produced in rabbit
Human GHITM human
Sigma-Aldrich
HPA016464
(Sigma-Aldrich Cat# HPA016464, RRID:AB_1849656)
unknown
rabbit
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Anti-GHITM antibody produced in rabbit
GHITM antibody produced in rabbit human, human
Sigma-Aldrich
HPA016464
(Sigma-Aldrich Cat# HPA016464, RRID:AB_1849656)
polyclonal antibody
rabbit
Vendor recommendations: Other; Western Blot; Immunofluorescence; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Anti-GHITM polyclonal antibody
GHITM See NCBI gene human
Atlas Antibodies Go To Vendor
HPA016464
(Atlas Antibodies Cat# HPA016464, RRID:AB_1849656)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK; Manufacturer approved use: IHC