Showing 1 - 3 results out of 3 with the query:
AB_1851807
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-INSL6 antibody produced in rabbit
Human INSL6 human
Sigma-Aldrich
HPA021364
(Sigma-Aldrich Cat# HPA021364, RRID:AB_1851807)
unknown
rabbit
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
ecdf4695-6970-5801-ad2b-5202d6f6c617
Anti-INSL6 polyclonal antibody
INSL6 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA021364
(Atlas Antibodies Cat# HPA021364, RRID:AB_1851807)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKD; Manufacturer approved use: IHC, WB
3a874f5b-909a-5fc3-b6a3-bdde12513a14
Anti-INSL6 antibody produced in rabbit
INSL6 antibody produced in rabbit human, human
Sigma-Aldrich
HPA021364
(Sigma-Aldrich Cat# HPA021364, RRID:AB_1851807)
polyclonal antibody
rabbit
Vendor recommendations: Other; Western Blot; Immunohistochemistry; Immunofluorescence; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
983b7386-bf1e-5eb3-85b4-108d32c7ee73