Showing 1 - 3 results out of 3 with the query:
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Clone ID
Host Organism
IRF8-human antibody
IRF8 homo sapiens
Sigma-Aldrich Go To Vendor
(Sigma-Aldrich Cat# HPA002531, RRID:AB_1851904)
ENCODE PROJECT External validation DATA SET is released testing lot A70819 for MCF-7,HeLa-S3,GM12878,K562,liver,HepG2; status is not eligible for new data,awaiting lab characterization
Anti-IRF8 polyclonal antibody
IRF8 See NCBI gene human
Atlas Antibodies Go To Vendor
(Atlas Antibodies Cat# HPA002531, RRID:AB_1851904)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYY; Manufacturer approved use: ICC-IF, IHC, WB
Anti-IRF8 antibody produced in rabbit
IRF8 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA002531, RRID:AB_1851904)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunohistochemistry