Showing 1 - 3 results out of 3 with the query:
AB_1854178
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-MTHFD1 antibody produced in rabbit
Human MTHFD1 human
Sigma-Aldrich
HPA015006
(Sigma-Aldrich Cat# HPA015006, RRID:AB_1854178)
unknown
rabbit
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Anti-MTHFD1 antibody produced in rabbit
MTHFD1 antibody produced in rabbit human, human
Sigma-Aldrich
HPA015006
(Sigma-Aldrich Cat# HPA015006, RRID:AB_1854178)
polyclonal antibody
rabbit
Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunofluorescence; Immunohistochemistry; Western Blot
Anti-MTHFD1 polyclonal antibody
MTHFD1 See NCBI gene human, rat, mouse
Atlas Antibodies Go To Vendor
HPA015006
(Atlas Antibodies Cat# HPA015006, RRID:AB_1854178)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence AANNLVAAAIDARIFHELTQTDKALFNRLVPSVNGVRRFSDIQIRRLKRLGIEKTDPTTLTDEEINRFARLDIDPETITWQRVLDTNDRFLRKITIGQAPTEKGHTRTAQFDISVASEIMAVLALTTSLEDMRERLGKMVVASSK; Manufacturer approved use: IHC, WB