Showing 1 - 3 results out of 3 with the query:
AB_1854450
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-NGEF antibody produced in rabbit
Human NGEF human
Sigma-Aldrich
HPA008160
(Sigma-Aldrich Cat# HPA008160, RRID:AB_1854450)
unknown
rabbit
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Anti-NGEF polyclonal antibody
NGEF See NCBI gene human
Atlas Antibodies Go To Vendor
HPA008160
(Atlas Antibodies Cat# HPA008160, RRID:AB_1854450)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence METRESEDLEKTRRKSASDQWNTDNEPAKVKPELLPEKEETSQADQDIQDKEPHCHIPIKRNSIFNRSIRRKSKAKARDNPERNASCLADSQDNGKSVNEPLTLNIPWSRTPPCRTAMQTDPGAQEMSESSST; Manufacturer approved use: IHC
Anti-NGEF antibody produced in rabbit
NGEF antibody produced in rabbit human, human
Sigma-Aldrich
HPA008160
(Sigma-Aldrich Cat# HPA008160, RRID:AB_1854450)
polyclonal antibody
rabbit
Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable