Showing 1 - 3 results out of 3 with the query:
AB_1854664
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-NT5C2 antibody produced in rabbit
Human NT5C2 human
Sigma-Aldrich
HPA003751
(Sigma-Aldrich Cat# HPA003751, RRID:AB_1854664)
unknown
rabbit
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Anti-NT5C2 polyclonal antibody
NT5C2 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA003751
(Atlas Antibodies Cat# HPA003751, RRID:AB_1854664)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KHLDSSSNERPDISSIQRRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLA; Manufacturer approved use: IHC
Anti-NT5C2 antibody produced in rabbit
NT5C2 antibody produced in rabbit human, human
Sigma-Aldrich
HPA003751
(Sigma-Aldrich Cat# HPA003751, RRID:AB_1854664)
polyclonal antibody
rabbit
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Western Blot; Other