Showing 1 - 3 results out of 3 with the query:
AB_1854785
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-OR10S1 antibody produced in rabbit
Human OR10S1 human
Sigma-Aldrich
HPA019038
(Sigma-Aldrich Cat# HPA019038, RRID:AB_1854785)
unknown
rabbit
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
9313a9c9-2f36-51e9-83f9-56ef9112eef7
Anti-OR10S1 polyclonal antibody
OR10S1 See NCBI gene human
Atlas Antibodies
HPA019038
(Atlas Antibodies Cat# HPA019038, RRID:AB_1854785)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MTSRSVCEKMTMTTENPNQTVVSHFFLEGLRYTAKHSSL; Manufacturer approved use: IHC
4cd95177-6960-5897-8516-e2ef0e2f346a
Anti-OR10S1 antibody produced in rabbit
OR10S1 antibody produced in rabbit human, human
Sigma-Aldrich
HPA019038
(Sigma-Aldrich Cat# HPA019038, RRID:AB_1854785)
polyclonal antibody
rabbit
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
9f28c2f7-804d-5a7e-a8ea-9011a497c9e9