Showing 1 - 3 results out of 3 with the query:
AB_1856469
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-RPS6KB2 antibody produced in rabbit
Human RPS6KB2 human
Sigma-Aldrich
HPA010010
(Sigma-Aldrich Cat# HPA010010, RRID:AB_1856469)
unknown
rabbit
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
4a8b8e4b-31a7-51f5-9fb1-c7dc7e0acde4
Anti-RPS6KB2 antibody produced in rabbit
RPS6KB2 antibody produced in rabbit human, human
Sigma-Aldrich
HPA010010
(Sigma-Aldrich Cat# HPA010010, RRID:AB_1856469)
polyclonal antibody
rabbit
Vendor recommendations: Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
655bfcc9-43cd-5ce4-9ccd-9bb152b7ab87
Anti-RPS6KB2 polyclonal antibody
RPS6KB2 See NCBI gene human, rat, mouse
Atlas Antibodies Go To Vendor
HPA010010
(Atlas Antibodies Cat# HPA010010, RRID:AB_1856469)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK; Manufacturer approved use: IHC, WB
3e402a57-367c-5d5c-aefe-5801c45d6030