Showing 1 - 3 results out of 3 with the query:
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Clone ID
Host Organism
Anti-DIABLO antibody produced in rabbit
Human DIABLO human
(Sigma-Aldrich Cat# HPA001825, RRID:AB_1857247)
Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Anti-DIABLO antibody produced in rabbit
DIABLO antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA001825, RRID:AB_1857247)
polyclonal antibody
Vendor recommendations: Other; Western Blot; Immunohistochemistry; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Anti-DIABLO polyclonal antibody
DIABLO See NCBI gene human, rat
Atlas Antibodies Go To Vendor
(Atlas Antibodies Cat# HPA001825, RRID:AB_1857247)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence AVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEG; Manufacturer approved use: ICC-IF, IHC, WB