Showing 1 - 3 results out of 3 with the query:
AB_1859483
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-SLC30A10 antibody produced in rabbit
Human SLC30A10 human
(Sigma-Aldrich Cat# HPA017989, RRID:AB_1859483)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA017989
Anti-SLC30A10 antibody produced in rabbit
SLC30A10 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA017989, RRID:AB_1859483)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA017989
Anti-SLC30A10 polyclonal antibody
SLC30A10 See NCBI gene human
(Atlas Antibodies Cat# HPA017989, RRID:AB_1859483)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLHIKYPKDRGYQDASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGALPLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVS; Manufacturer approved use: IHC
rabbit
Atlas Antibodies Go To Vendor
HPA017989