Showing 1 - 3 results out of 3 with the query:
AB_1859510
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-AC007431.1 antibody produced in rabbit
Human AC007431.1 human
Sigma-Aldrich
HPA023446
(Sigma-Aldrich Cat# HPA023446, RRID:AB_1859510)
unknown
rabbit
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Anti-CCDC182 polyclonal antibody
CCDC182 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA023446
(Atlas Antibodies Cat# HPA023446, RRID:AB_1859510)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EDAFCEMNGALVQQEEQAARVRQRLREEEDRGIVRNKVLTFLLPREKQLREHCKRLEDLLLDRGRDALRATKKSQAD; Manufacturer approved use: IHC
Anti-AC007431.1 antibody produced in rabbit
AC007431.1 antibody produced in rabbit human, human
Sigma-Aldrich
HPA023446
(Sigma-Aldrich Cat# HPA023446, RRID:AB_1859510)
polyclonal antibody
rabbit
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry