Showing 1 - 4 results out of 4 with the query:
AB_2191905
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Cat Num
Anti-SNAI3 antibody produced in rabbit
SNAI3 human
(Sigma-Aldrich Cat# HPA016757, RRID:AB_2191905)
unknown
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
rabbit
Sigma-Aldrich
HPA016757
Anti-SNAI3 antibody produced in rabbit
SNAI3 human
(Sigma-Aldrich Cat# HPA016757, RRID:AB_2191905)
polyclonal antibody
Useful for immunohistochemistry
rabbit
Sigma-Aldrich
HPA016757
Anti-SNAI3 polyclonal antibody
SNAI3 See NCBI gene human
(Atlas Antibodies Cat# HPA016757, RRID:AB_2191905)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVLPTRWSPTLGPDRHGAPEKLLGAERMPRAPGGFECFHCHKPYHTLAGLARHRQLH; Manufacturer approved use: IHC
rabbit
Atlas Antibodies Go To Vendor
HPA016757
Anti-SNAI3 antibody produced in rabbit
SNAI3 antibody produced in rabbit human, human
(Sigma-Aldrich Cat# HPA016757, RRID:AB_2191905)
polyclonal antibody
Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
rabbit
Sigma-Aldrich
HPA016757