Showing 1 - 4 results out of 4 with the query:
AB_2256120
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Rabbit Anti-Human TMEM176A Prestige Antibodies?? Powered by Atlas Antibodies Antibody, Unconjugated
Human TMEM176A human
Sigma-Aldrich
HPA008770
(Sigma-Aldrich Cat# HPA008770, RRID:AB_2256120)
unknown
rabbit
Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Anti-TMEM176A antibody produced in rabbit
TMEM176A human
Sigma-Aldrich
HPA008770
(Sigma-Aldrich Cat# HPA008770, RRID:AB_2256120)
polyclonal antibody
rabbit
Useful for immunohistochemistry
Anti-TMEM176A antibody produced in rabbit
TMEM176A antibody produced in rabbit human, human
Sigma-Aldrich
HPA008770
(Sigma-Aldrich Cat# HPA008770, RRID:AB_2256120)
polyclonal antibody
rabbit
Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Anti-TMEM176A polyclonal antibody
TMEM176A See NCBI gene human
Atlas Antibodies Go To Vendor
HPA008770
(Atlas Antibodies Cat# HPA008770, RRID:AB_2256120)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MGTADSDEMAPEAPQHTHIDVHIHQESALAKLLLTCCSALRPRATQAR; Manufacturer approved use: IHC, WB