Showing 1 - 1 results out of 1 with the query:
AB_2666017
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clonality
Clone ID
Host Organism
Comments
Anti-TYMP polyclonal antibody
TYMP See NCBI gene human
Atlas Antibodies Go To Vendor
HPA000530
(Atlas Antibodies Cat# HPA000530, RRID:AB_2666017)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISG; Manufacturer approved use: ICC-IF, WB