Showing 1 - 1 results out of 1 with the query:
AB_2670630
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clonality
Clone ID
Host Organism
Comments
v_uuid
Anti-NUB1 polyclonal antibody
NUB1 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA021220
(Atlas Antibodies Cat# HPA021220, RRID:AB_2670630)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DNRQESPSQENIDRLVYMGFDALVAEAALRVFRGNVQLAAQTLAHNGGSLPPELPLSPEDSLSPPATSPSDSAGTSSASTDEDMETEAVNEILEDIPEHEEDYLDSTLEDEE; Manufacturer approved use: IHC, WB
3bf5a459-7709-5d59-8cc6-a24b792d8ba0