Showing 1 - 1 results out of 1 with the query:
AB_2675059
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clonality
Clone ID
Host Organism
Comments
v_uuid
Anti-GUSB polyclonal antibody
GUSB See NCBI gene human
Atlas Antibodies
HPA036323
(Atlas Antibodies Cat# HPA036323, RRID:AB_2675059)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TSHYPYAEEVMQMCDRYGIVVIDECPGVGLALPQFFNNVSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYLKMV; Manufacturer approved use: IHC, WB
48e1a522-9884-5797-bfff-67634b62d474