Showing 1 - 1 results out of 1 with the query:
AB_2678299
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clonality
Clone ID
Host Organism
Comments
Anti-SAMD4A polyclonal antibody
SAMD4A See NCBI gene human, rat, mouse
Atlas Antibodies Go To Vendor
HPA043061
(Atlas Antibodies Cat# HPA043061, RRID:AB_2678299)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MWLNHLEDRTSTSFGGQNRGRSDSVDYGQTHYYHQRQNSDDKLNGWQNSRDSGICINASNWQDKSMGCENGHVPLYSSSSVPTTINTIGTSTS; Manufacturer approved use: IHC, WB