Showing 1 - 1 results out of 1 with the query:
AB_2678383
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clonality
Clone ID
Host Organism
Comments
Anti-TYR polyclonal antibody
TYR See NCBI gene human
Atlas Antibodies Go To Vendor
HPA043241
(Atlas Antibodies Cat# HPA043241, RRID:AB_2678383)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence APIGHNRESYMVPFIPLYRNGDFFISSKDLGYDYSYLQDSDPDSFQDYIKSYLEQASRI; Manufacturer approved use: ICC-IF