Showing 1 - 1 results out of 1 with the query:
Antibody ID
Antibody Name
Target Antigen
Cat Num
Proper Citation
Clone ID
Host Organism
Anti-PSMB8 polyclonal antibody
PSMB8 See NCBI gene human
Atlas Antibodies Go To Vendor
(Atlas Antibodies Cat# HPA046995, RRID:AB_2679896)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ; Manufacturer approved use: IHC, WB