Showing 1 - 1 results out of 1 with the query:
AB_2680788
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clonality
Clone ID
Host Organism
Comments
v_uuid
Anti-NPHS2 polyclonal antibody
NPHS2 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA049486
(Atlas Antibodies Cat# HPA049486, RRID:AB_2680788)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEPLNPK; Manufacturer approved use: IHC
f1a26f41-85e1-5c18-b705-66bc63ed6130