Showing 1 - 1 results out of 1 with the query:
AB_2684909
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clonality
Clone ID
Host Organism
Comments
v_uuid
Anti-TFAP2B polyclonal antibody
TFAP2B See NCBI gene human
Atlas Antibodies
HPA062942
(Atlas Antibodies Cat# HPA062942, RRID:AB_2684909)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSS; Manufacturer approved use: ICC-IF, IHC
e66a0f72-3953-5247-88f0-b2694aab5773