Showing 1 - 1 results out of 1 with the query:
AB_2685575
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clonality
Clone ID
Host Organism
Comments
Anti-CBFA2T3 polyclonal antibody
CBFA2T3 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA065890
(Atlas Antibodies Cat# HPA065890, RRID:AB_2685575)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGPAPVDRKAKASAMPDSPAEVKTQPR; Manufacturer approved use: IHC, WB