Showing 1 - 1 results out of 1 with the query:
AB_2686211
Antibody ID
Antibody Name
Target Antigen
Vendor
Cat Num
Proper Citation
Reference
Clonality
Clone ID
Host Organism
Comments
v_uuid
Anti-SPIN2A polyclonal antibody
SPIN2A See NCBI gene human
Atlas Antibodies Go To Vendor
HPA069835
(Atlas Antibodies Cat# HPA069835, RRID:AB_2686211)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQ; Manufacturer approved use: ICC-IF
739d4db1-08ee-5a76-92e9-c76e1c492c36