Showing 1 - 20 results out of 931 with the query:
*
with facets:
Target Antigen:CD28 X
Alexa Fluor® 647 anti-human CD28 antibody
CD28 See NCBI gene human, baboon, capuchin monkey, chimpanzee, cynomolgus, pigtailed macaque, rhesus, sooty mangabey, squirrel monkey
BioLegend Go To Vendor
302954
(BioLegend Cat# 302954, RRID:AB_2721413)
monoclonal antibody
CD28.2
mouse
Validated Applications: FC. ISO 9001: 2008 and ISO 13485: 2003
CD28 antibody
CD28 mouse
BD Biosciences Go To Vendor
562767
(BD Biosciences Cat# 562767, RRID:AB_2737780)
monoclonal antibody
37.51
syrian hamster
Flow cytometry
Brilliant Violet 421™ anti-mouse CD28 antibody
CD28 See NCBI gene mouse
BioLegend Go To Vendor
102127
(BioLegend Cat# 102127, RRID:AB_2650628)
monoclonal antibody
37.51
syrian hamster
Applications: FC
CD28-VioBright FITC, human antibody
CD28 human
Miltenyi Biotec
130-109-445
(Miltenyi Biotec Cat# 130-109-445, RRID:AB_2656952)
monoclonal antibody
REA612
human
discontinued 11/2018; Target Distribution B cells, lymphocytes, plasma cells, T cells, thymocytes; target type CD markers, REAfinity Antibodies; tested applications MACS Flow Cytometry; quantity:
CD28-APC-Vio770, human antibody
CD28 human
Miltenyi Biotec
130-109-444
(Miltenyi Biotec Cat# 130-109-444, RRID:AB_2656960)
monoclonal antibody
REA612
human
11/2018; Target Distribution B cells, lymphocytes, plasma cells, T cells, thymocytes; target type CD markers, REAfinity Antibodies; tested applications MACS Flow Cytometry; quantity:
CD28-PE, rat antibody
CD28 rat
Miltenyi Biotec Go To Vendor
130-103-332
(Miltenyi Biotec Cat# 130-103-332, RRID:AB_2656943)
monoclonal antibody
REA206
human
Entered market 2013-12-01; Target Distribution T cells; target type CD markers, REAfinity Antibodies; tested applications MACS Flow Cytometry; quantity:9 µg in 300 µL
CD28-PE-Vio770, rat antibody
CD28 rat
Miltenyi Biotec Go To Vendor
130-103-330
(Miltenyi Biotec Cat# 130-103-330, RRID:AB_2656947)
monoclonal antibody
REA206
human
Entered market 2013-12-01; Target Distribution T cells; target type CD markers, REAfinity Antibodies; tested applications MACS Flow Cytometry; quantity:9 µg in 300 µL
CD28-PE-Vio770, human antibody
CD28 human
Miltenyi Biotec Go To Vendor
130-109-443
(Miltenyi Biotec Cat# 130-109-443, RRID:AB_2656958)
monoclonal antibody
REA612
human
Entered market 2015-12-01; Target Distribution B cells, lymphocytes, plasma cells, T cells, thymocytes; target type CD markers, REAfinity Antibodies; tested applications MACS Flow Cytometry; quantity:
CD28-APC-Vio770, human antibody
CD28 human
Miltenyi Biotec
130-109-523
(Miltenyi Biotec Cat# 130-109-523, RRID:AB_2656959)
monoclonal antibody
REA612
human
11/2018; Target Distribution B cells, lymphocytes, plasma cells, T cells, thymocytes; target type CD markers, REAfinity Antibodies; tested applications MACS Flow Cytometry; quantity:
CD28-PE, mouse antibody
CD28 mouse
Miltenyi Biotec Go To Vendor
130-111-972
(Miltenyi Biotec Cat# 130-111-972, RRID:AB_2656963)
monoclonal antibody
REA806
human
Entered market 2017-01-03; Target Distribution B cells, lymphocytes, plasma cells, T cells, thymocytes; target type CD markers, REAfinity Antibodies; tested applications MACS Flow Cytometry; quantity:30 µg in 200 µL
CD28-APC, mouse antibody
CD28 mouse
Miltenyi Biotec Go To Vendor
130-111-820
(Miltenyi Biotec Cat# 130-111-820, RRID:AB_2656966)
monoclonal antibody
REA806
human
Entered market 2017-01-03; Target Distribution B cells, lymphocytes, plasma cells, T cells, thymocytes; target type CD markers, REAfinity Antibodies; tested applications MACS Flow Cytometry; quantity:150 µg in 1 mL
CD28-PE-Vio770, human antibody
CD28 human, non-human primate
Miltenyi Biotec Go To Vendor
130-104-189
(Miltenyi Biotec Cat# 130-104-189, RRID:AB_2660268)
monoclonal antibody
1500000000
mouse
Entered market 2014-12-01; Target Distribution B cells, lymphocytes, plasma cells, T cells, thymocytes; target type CD markers; tested applications MACS Flow Cytometry; quantity:
CD28-Biotin, human antibody
CD28 human, non-human primate
Miltenyi Biotec Go To Vendor
130-100-444
(Miltenyi Biotec Cat# 130-100-444, RRID:AB_2660271)
monoclonal antibody
1500000000
mouse
Entered market 2013-07-01; Target Distribution B cells, lymphocytes, plasma cells, T cells, thymocytes; target type CD markers; tested applications MACS Flow Cytometry; quantity:
CD28-PE, mouse antibody
CD28 mouse
Miltenyi Biotec Go To Vendor
130-102-601
(Miltenyi Biotec Cat# 130-102-601, RRID:AB_2660825)
monoclonal antibody
37.51
hamster
Entered market 2013-12-01; Target Distribution B cells, lymphocytes, plasma cells, T cells, thymocytes; target type CD markers; tested applications MACS Flow Cytometry; quantity:30 µg in 1 mL
Anti-CD28 polyclonal antibody
CD28 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA070003
(Atlas Antibodies Cat# HPA070003, RRID:AB_2686226)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS; Manufacturer approved use: IHC
CD28 antibody
CD28 human
BD Biosciences Go To Vendor
564438
(BD Biosciences Cat# 564438, RRID:AB_2738808)
monoclonal antibody
CD28.2
mouse
Flow cytometry
Anti-CD28 antibody
CD28 human
LifeSpan
LS-C84966-200
(LifeSpan Cat# LS-C84966-200, RRID:AB_2032906)
monoclonal antibody
mouse
vendor suggested use: IgG1; IgG1
Anti-CD28 antibody
CD28 human
LifeSpan
LS-C84967-100
(LifeSpan Cat# LS-C84967-100, RRID:AB_1664711)
monoclonal antibody
mouse
vendor suggested use: IgG1; IgG1
Anti-CD28 antibody
CD28 rat, rat
LifeSpan
LS-C62627-500
(LifeSpan Cat# LS-C62627-500, RRID:AB_1648475)
monoclonal antibody
mouse
vendor suggested use: IgG1; IgG1 Flow Cytometry; Flo (1 µg/1E6 cells)
CD28 antibody
CD28 non-human primate, rhesus, baboon, cynomolgus
BD Biosciences Go To Vendor
560683
(BD Biosciences Cat# 560683, RRID:AB_1727458)
monoclonal antibody
mouse
Flow cytometry