Showing 1 - 20 results out of 789 with the query:
*
with facets:
Target Antigen:GFAP X
Purified anti-GFAP antibody
GFAP See NCBI gene human, mammalian, rat
BioLegend Go To Vendor
837404
(BioLegend Cat# 837404, RRID:AB_2650686)
monoclonal antibody
SMI 24
mouse
Applications: IHC-P, WB
Direct-Blotâ„¢ HRP anti-GFAP antibody
GFAP See NCBI gene human, mouse, rat
BioLegend Go To Vendor
644711
(BioLegend Cat# 644711, RRID:AB_2650857)
monoclonal antibody
2E1.E9
mouse
Applications: WB
Anti-GFAP-PE, human, mouse, rat antibody
GFAP human, mouse, rat
Miltenyi Biotec
130-105-326
(Miltenyi Biotec Cat# 130-105-326, RRID:AB_2651831)
monoclonal antibody
REA335
human
11/2018; Target Distribution astrocytes, CNS cells; target type Non-CD markers, REAfinity Antibodies; tested applications MACS Flow Cytometry; quantity:
Anti-GFAP-APC, human, mouse, rat antibody
GFAP human, mouse, rat
Miltenyi Biotec Go To Vendor
130-105-328
(Miltenyi Biotec Cat# 130-105-328, RRID:AB_2651832)
monoclonal antibody
REA335
human
Entered market 2014-07-01; Target Distribution astrocytes, CNS cells; target type Non-CD markers, REAfinity Antibodies; tested applications MACS Flow Cytometry; quantity:
HRP anti-GFAP antibody
GFAP See NCBI gene human, mouse, rat
BioLegend Go To Vendor
837505
(BioLegend Cat# 837505, RRID:AB_2721603)
monoclonal antibody
SMI 25
mouse
Validated Applications: IHC-P, WB. ISO 9001: 2008 and ISO 13485: 2003
Anti-GFAP polyclonal antibody
GFAP See NCBI gene human
Atlas Antibodies Go To Vendor
HPA063513
(Atlas Antibodies Cat# HPA063513, RRID:AB_2685027)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERD; Manufacturer approved use: IHC
GFAP R416WT Antibody, ATTO 390 Conjugate
GFAP See NCBI gene human, mouse, rat
StressMarq Biosciences Go To Vendor
SMC-442D-A390
(StressMarq Biosciences Cat# SMC-442D-A390, RRID:AB_2701704)
monoclonal antibody
S206B-9
mouse
Vendor recommended applications: WB, IHC, ICC/IF
GFAP R416WT Antibody, PE/ATTO 594 Conjugate
GFAP See NCBI gene human, mouse, rat
StressMarq Biosciences Go To Vendor
SMC-442D-P594
(StressMarq Biosciences Cat# SMC-442D-P594, RRID:AB_2701717)
monoclonal antibody
S206B-9
mouse
Vendor recommended applications: WB, IHC, ICC/IF
GFAP R416WT Antibody, Biotin Conjugate
GFAP See NCBI gene human, mouse, rat
StressMarq Biosciences Go To Vendor
SMC-442D-BI
(StressMarq Biosciences Cat# SMC-442D-BI, RRID:AB_2701714)
monoclonal antibody
S206B-9
mouse
Vendor recommended applications: WB, IHC, ICC/IF
GFAP R416WT Antibody, ATTO 680 Conjugate
GFAP See NCBI gene human, mouse, rat
StressMarq Biosciences Go To Vendor
SMC-442D-A680
(StressMarq Biosciences Cat# SMC-442D-A680, RRID:AB_2701710)
monoclonal antibody
S206B-9
mouse
Vendor recommended applications: WB, IHC, ICC/IF
GFAP R416WT Antibody, ATTO 655 Conjugate
GFAP See NCBI gene human, mouse, rat
StressMarq Biosciences Go To Vendor
SMC-442D-A655
(StressMarq Biosciences Cat# SMC-442D-A655, RRID:AB_2701709)
monoclonal antibody
S206B-9
mouse
Vendor recommended applications: WB, IHC, ICC/IF
GFAP R416WT Antibody, ATTO 565 Conjugate
GFAP See NCBI gene human, mouse, rat
StressMarq Biosciences Go To Vendor
SMC-442D-A565
(StressMarq Biosciences Cat# SMC-442D-A565, RRID:AB_2701706)
monoclonal antibody
S206B-9
mouse
Vendor recommended applications: WB, IHC, ICC/IF
GFAP R416WT Antibody, ATTO 488 Conjugate
GFAP See NCBI gene human, mouse, rat
StressMarq Biosciences Go To Vendor
SMC-442D-A488
(StressMarq Biosciences Cat# SMC-442D-A488, RRID:AB_2701705)
monoclonal antibody
S206B-9
mouse
Vendor recommended applications: WB, IHC, ICC/IF
GFAP Antibody, Streptavidin Conjugate
GFAP See NCBI gene human, mouse, rat
StressMarq Biosciences Go To Vendor
SMC-441D-STR
(StressMarq Biosciences Cat# SMC-441D-STR, RRID:AB_2701702)
monoclonal antibody
S206A-8
mouse
Vendor recommended applications: WB, IHC, ICC/IF
GFAP Antibody, RPE Conjugate
GFAP See NCBI gene human, mouse, rat
StressMarq Biosciences Go To Vendor
SMC-441D-RPE
(StressMarq Biosciences Cat# SMC-441D-RPE, RRID:AB_2701701)
monoclonal antibody
S206A-8
mouse
Vendor recommended applications: WB, IHC, ICC/IF
GFAP Antibody, PE/ATTO 594 Conjugate
GFAP See NCBI gene human, mouse, rat
StressMarq Biosciences Go To Vendor
SMC-441D-P594
(StressMarq Biosciences Cat# SMC-441D-P594, RRID:AB_2701699)
monoclonal antibody
S206A-8
mouse
Vendor recommended applications: WB, IHC, ICC/IF
GFAP Antibody, Biotin Conjugate
GFAP See NCBI gene human, mouse, rat
StressMarq Biosciences Go To Vendor
SMC-441D-BI
(StressMarq Biosciences Cat# SMC-441D-BI, RRID:AB_2701696)
monoclonal antibody
S206A-8
mouse
Vendor recommended applications: WB, IHC, ICC/IF
GFAP Antibody, ATTO 655 Conjugate
GFAP See NCBI gene human, mouse, rat
StressMarq Biosciences Go To Vendor
SMC-441D-A655
(StressMarq Biosciences Cat# SMC-441D-A655, RRID:AB_2701691)
monoclonal antibody
S206A-8
mouse
Vendor recommended applications: WB, IHC, ICC/IF
GFAP Antibody, ATTO 633 Conjugate
GFAP See NCBI gene human, mouse, rat
StressMarq Biosciences Go To Vendor
SMC-441D-A633
(StressMarq Biosciences Cat# SMC-441D-A633, RRID:AB_2701690)
monoclonal antibody
S206A-8
mouse
Vendor recommended applications: WB, IHC, ICC/IF
GFAP Antibody, ATTO 594 Conjugate
GFAP See NCBI gene human, mouse, rat
StressMarq Biosciences Go To Vendor
SMC-441D-A594
(StressMarq Biosciences Cat# SMC-441D-A594, RRID:AB_2701689)
monoclonal antibody
S206A-8
mouse
Vendor recommended applications: WB, IHC, ICC/IF