Showing 1 - 20 results out of 21,310 with the query:
*
with facets:
Vendor:Atlas Antibodies X
Antibody ID
Antibody Name
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-AAK1 polyclonal antibody
AAK1 See NCBI gene human
Atlas Antibodies
HPA017931
(Atlas Antibodies Cat# HPA017931, RRID:AB_1844406)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LLNKDFAKLGEGKHPEKLGGSAESLIPGFQSTQGDAFATTSFSAGTAEKRKGGQTVDSGLPLLSVSDPFIPLQVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFGSTSDAVIGKVIISVSSVMHDMCA; Manufacturer approved use: ICC-IF, IHC
33332ac0-0a33-5b0c-b815-02988f5d962c
Anti-LRRC8B polyclonal antibody
LRRC8B See NCBI gene human
Atlas Antibodies
HPA017950
(Atlas Antibodies Cat# HPA017950, RRID:AB_1853346)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSSSGCSADIDSGKQSLPYPQPGLESAGIESPTSSVLDKKEGEQAKAIFEKVKRFRMHVEQKD; Manufacturer approved use: ICC-IF, IHC
92a777ed-1bd3-5ebc-9342-0634b90294b0
Anti-PALMD polyclonal antibody
PALMD See NCBI gene human
Atlas Antibodies
HPA017959
(Atlas Antibodies Cat# HPA017959, RRID:AB_1854949)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YDDGQKSVYAVSSNHSAAYNGTDGLAPVEVEELLRQASERNSKSPTEYHEPVYANPFYRPTTPQRETVTPGPNFQERIKIKTNGLGIGVNESIHNMGNGLSEERGNNFNHISPIPPVPHPRSVIQQAEEKLHTP; Manufacturer approved use: ICC-IF, IHC, WB
8ca5ff7d-c6ac-5e06-a90b-10cf61d18055
Anti-HLA-DPA1 polyclonal antibody
HLA-DPA1 See NCBI gene human
Atlas Antibodies
HPA017967
(Atlas Antibodies Cat# HPA017967, RRID:AB_1853929)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTF; Manufacturer approved use: IHC
9c9c6609-6de3-503f-bd60-93963b34e78e
Anti-PLEKHG2 polyclonal antibody
PLEKHG2 See NCBI gene human
Atlas Antibodies
HPA017973
(Atlas Antibodies Cat# HPA017973, RRID:AB_2669719)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ATRRELFSGSNPGKLGEPPSGGKAGPEEDEEGVSFTDFQPQDVTQHQGFPDELAFRSCSEIRSAWQALEQGQLARPGFPEPLLILEDSDLGGDSGSGKAGAPSSERTASRVRELARLYSERI; Manufacturer approved use: IHC
35a665dd-737f-5a84-a8b8-4264c52f7610
Anti-MFAP3L polyclonal antibody
MFAP3L See NCBI gene human
Atlas Antibodies
HPA017986
(Atlas Antibodies Cat# HPA017986, RRID:AB_1853842)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TNSTLNGTNVVLGSVPVIIARTDHIIVKEGNSALINCSVYGIPDPQFKWYNSIGKLLKEEEDEKERGGGKWQMHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGD; Manufacturer approved use: IHC
d9cb0489-6777-5cb6-aeee-932192a329a4
Anti-ITSN1 polyclonal antibody
ITSN1 See NCBI gene human
Atlas Antibodies
HPA018007
(Atlas Antibodies Cat# HPA018007, RRID:AB_1851836)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTKKDGDWW; Manufacturer approved use: IHC, WB
005c68cf-72b6-5577-8ac4-75e6aeea299c
Anti-SCARB2 polyclonal antibody
SCARB2 See NCBI gene human
Atlas Antibodies
HPA018014
(Atlas Antibodies Cat# HPA018014, RRID:AB_1852881)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGD; Manufacturer approved use: IHC, WB
549a727d-e111-578e-b83c-73ea1d32b0c2
Anti-PLPPR5 polyclonal antibody
PLPPR5 See NCBI gene human
Atlas Antibodies
HPA018072
(Atlas Antibodies Cat# HPA018072, RRID:AB_1854958)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EHIHMDNLAQMPMISIPRVESPLEKVTSVQNHITAFAEVT; Manufacturer approved use: ICC-IF, IHC
d39d42f2-c4b0-52ba-87d2-9eb5ce1294a0
Anti-RRAGC polyclonal antibody
RRAGC See NCBI gene human
Atlas Antibodies
HPA018247
(Atlas Antibodies Cat# HPA018247, RRID:AB_1856475)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence CILREESFERKGLIDYNFHCFRKAIHEVFEVGVTSHRSCGHQTSASSLKALT; Manufacturer approved use: IHC, WB
71ef60fb-54e8-583e-98a8-db3d8b96adde
Anti-BMPER polyclonal antibody
BMPER See NCBI gene human
Atlas Antibodies
HPA018083
(Atlas Antibodies Cat# HPA018083, RRID:AB_1847343)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence FGSCLFRSDVYDNGSSFLYDNCTACTCRDSTVVCKRKCSHPGGCDQGQEGCCEECLLRVPPEDIKVCKFGNKIFQDGEMWSSINCTICACVKGRTECRNKQCIPISSCPQGKILNRKGCCPICTEKPGVCTVFGD; Manufacturer approved use: IHC, WB
1e60fdd8-3679-58a8-ba8a-726f1ccb3f00
Anti-C14orf177 polyclonal antibody
C14orf177 See NCBI gene human
Atlas Antibodies
HPA018091
(Atlas Antibodies Cat# HPA018091, RRID:AB_1848845)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence HRKEPGARLEATRGAARPHKQGTKPMITRPSVSQLGEGKCPSSQHLQSLRHNKQHALTLTKARCCGECSTCFCTEEKSECQRHEETSPGSCNHQIMSASTISAFCATPRFKQLFKGTVEQMSQM; Manufacturer approved use: IHC, WB
f73e9d5b-dc92-556d-b4a4-b699d67112b5
Anti-PLPP6 polyclonal antibody
PLPP6 See NCBI gene human
Atlas Antibodies
HPA018096
(Atlas Antibodies Cat# HPA018096, RRID:AB_1855609)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PAHNQMDMFVTLSVDKYSFPSGHATRAALMSR; Manufacturer approved use: ICC-IF, IHC, WB
abe9990d-0aef-52a9-9338-9a5df07a67dd
Anti-GNAS polyclonal antibody
GNAS See NCBI gene human
Atlas Antibodies
HPA018122
(Atlas Antibodies Cat# HPA018122, RRID:AB_1849236)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SETDFETEPETAPTTEPETEPEDDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGEELKPEDKDPRDPEESKEPKEEKQRRRCKPKKPTR; Manufacturer approved use: IHC
811aa2ac-a6e3-5293-95b0-cc51e84aaedf
Anti-GOT2 polyclonal antibody
GOT2 See NCBI gene human, rat, mouse
Atlas Antibodies
HPA018139
(Atlas Antibodies Cat# HPA018139, RRID:AB_1849903)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVER; Manufacturer approved use: IHC, WB
797370bd-9988-52d7-bebe-e6358e571385
Anti-FARS2 polyclonal antibody
FARS2 See NCBI gene human
Atlas Antibodies
HPA018148
(Atlas Antibodies Cat# HPA018148, RRID:AB_1848426)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GTPLFSVYDNLSPVVTTWQNFDSLLIPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLFSKHELFAGIKDGES; Manufacturer approved use: IHC, WB
470785b0-0907-5747-8428-6e393fa4b100
Anti-SLC30A4 polyclonal antibody
SLC30A4 See NCBI gene human
Atlas Antibodies
HPA018178
(Atlas Antibodies Cat# HPA018178, RRID:AB_1857087)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PSHLNVDYIKEALMKIEDVYSVEDLNIWSLTSGKSTAIVHIQLIPGSSSKWEEVQSKANHLLLNTFGMYRCTIQLQSYRQEVDRTCANCQ; Manufacturer approved use: IHC
93f542f6-97b4-56d1-853a-88acfad58c6f
Anti-TMEM87A polyclonal antibody
TMEM87A See NCBI gene human
Atlas Antibodies
HPA018189
(Atlas Antibodies Cat# HPA018189, RRID:AB_2205198)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TTIFLKFDGEPCDLSLNITWYLKSADCYNEIYNFKAEEVELYLEKLKEKRGLSGKYQTSSKLFQNCSELFKTQTFSGDFMHRLPLLGEKQEAKENGTN; Manufacturer approved use: ICC-IF, IHC
c5bfe06d-2fef-5813-b9ec-4fc3d43e6891
Anti-SESN2 polyclonal antibody
SESN2 See NCBI gene human
Atlas Antibodies
HPA018191
(Atlas Antibodies Cat# HPA018191, RRID:AB_1856750)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence HSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGY; Manufacturer approved use: ICC-IF, IHC
04f6a581-442e-5757-ac56-f21031982432
Anti-DUSP26 polyclonal antibody
DUSP26 See NCBI gene human
Atlas Antibodies
HPA018221
(Atlas Antibodies Cat# HPA018221, RRID:AB_2669813)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence CPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVL; Manufacturer approved use: ICC-IF, IHC, WB
4d441167-43bd-5404-b410-bff67c06d179