Showing 1 - 20 results out of 22,044 with the query:
*
with facets:
Vendor:Atlas Antibodies X
Antibody ID
Antibody Name
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-TTC22 polyclonal antibody
TTC22 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035072
(Atlas Antibodies Cat# HPA035072, RRID:AB_10602252)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GMPDRNHLACAKADLEEVVRVCPGFKAYLDIGQVYYYMGVDAVQELLAVDEAALNQALVFLAKAGESELGATLPELQLLRGKCLRIKGED; Manufacturer approved use: IHC
844ea400-5d02-523b-b8de-cb2a402d7780
Anti-GPR152 polyclonal antibody
GPR152 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035078
(Atlas Antibodies Cat# HPA035078, RRID:AB_10670286)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DLRTLLRSVLSSFAAALCEERPGSFTPTEPQTQLDSEGPTLPEPMAEAQSQMDPVAQPQVNPTLQPRSDPTAQPQLNPTAQ; Manufacturer approved use: IHC
23c93356-3123-555d-9eb4-b10404e14a2e
Anti-XKR3 polyclonal antibody
XKR3 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035081
(Atlas Antibodies Cat# HPA035081, RRID:AB_2674451)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence METVFEEMDEESTGGVSSSKEEIVLGQRLH; Manufacturer approved use: IHC
39f66c6a-4b14-5e28-a7f2-e4da7fce2e5e
Anti-ATP6V1A polyclonal antibody
ATP6V1A See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035084
(Atlas Antibodies Cat# HPA035084, RRID:AB_2674454)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQT; Manufacturer approved use: ICC-IF
fc190895-0eed-5716-82e6-ab44ad73b012
Anti-ZNF263 polyclonal antibody
ZNF263 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035086
(Atlas Antibodies Cat# HPA035086, RRID:AB_10603244)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PGEEKFENLEGVPSVCSENIHPQVLLPDQARGEVPWSPELGRPHDRSQGDWAPPPEGGMEQALAGASSGRELGRPKELQPKKLHLCPL; Manufacturer approved use: ICC-IF, IHC, WB
80a21221-1c4f-57c1-bf45-42a029eb2f70
Anti-KIAA0556 polyclonal antibody
KIAA0556 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035089
(Atlas Antibodies Cat# HPA035089, RRID:AB_10671509)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VVLEFNPASKSHKRERNLSAKRKDNAEVFVPTKPEPNLTPQAPAVFPDQERMCSRPGSRRERPLSATRKTLCEAEYPEEDASAVLQAIQVENA; Manufacturer approved use: IHC
0dc3940a-2761-5707-a232-3d0edac3b172
Anti-MBNL1 polyclonal antibody
MBNL1 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035098
(Atlas Antibodies Cat# HPA035098, RRID:AB_2674461)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPA; Manufacturer approved use: ICC-IF, IHC, WB
ab612812-05d1-59b6-80ca-6d56ce286876
Anti-ZFP64 polyclonal antibody
ZFP64 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035112
(Atlas Antibodies Cat# HPA035112, RRID:AB_10672859)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SFDTKQPSNLSKHMKKFHGDMVKTEALERKDTGRQSSRQVAKLDAKKSFHCDICDASFMREDSLRSHKRQHSEYSESKNSDVTVLQFQIEPS; Manufacturer approved use: IHC
f651c83c-3580-521a-8449-00e3b4a831a6
Anti-SLC9A2 polyclonal antibody
SLC9A2 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035121
(Atlas Antibodies Cat# HPA035121, RRID:AB_10602894)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LEIKHAIEMAETGMISTVPTFASLNDCREEKIRKVTSSETDEIRELLSRNLYQIR; Manufacturer approved use: IHC
cd0b7f6f-4201-5f48-a49a-a2bbc286f083
Anti-SLC9A2 polyclonal antibody
SLC9A2 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035122
(Atlas Antibodies Cat# HPA035122, RRID:AB_2674477)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SLRESIRKDSSLNREHRASTSTSRYLSLPKNTKLPEKLQKRRTISIADGNSSDSDADAGTTVLNLQPRARRFLPEQFSKKS; Manufacturer approved use: IHC, WB
a6768359-952b-5dd7-bcf4-7137dd63a0c2
Anti-FSD1L polyclonal antibody
FSD1L See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035138
(Atlas Antibodies Cat# HPA035138, RRID:AB_10601324)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MDSQKEALQRIISTLANKNDEIQNFIDTLHHTLKGVQENSSNILSELDEEFDSLYSILDEVKESMINCIKQEQA; Manufacturer approved use: IHC
4a445f41-6bba-5a64-9d09-e9d765944fb9
Anti-STAC polyclonal antibody
STAC See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035143
(Atlas Antibodies Cat# HPA035143, RRID:AB_10603892)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GSDSPHRTSTSDLVEVPEEANGPGGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQGSLSKDPLQMNTY; Manufacturer approved use: IHC
38f28227-7914-5ce1-9465-4747967daae5
Anti-IGF2BP2 polyclonal antibody
IGF2BP2 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035145
(Atlas Antibodies Cat# HPA035145, RRID:AB_2674491)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ITVKGTVEACASAEIEIMKKLREAFENDMLAVNTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAV; Manufacturer approved use: ICC-IF, IHC
4d1f3867-7d13-58e6-8556-406ff3eb399a
Anti-MOBP polyclonal antibody
MOBP See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035152
(Atlas Antibodies Cat# HPA035152, RRID:AB_10603020)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTR; Manufacturer approved use: IHC, WB
9d691d00-129e-5e0c-a747-555022e1240b
Anti-ZFAND2B polyclonal antibody
ZFAND2B See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035160
(Atlas Antibodies Cat# HPA035160, RRID:AB_10670697)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence CPLCNVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKH; Manufacturer approved use: ICC-IF, IHC, WB
ecf45766-7d88-564a-8500-9b897b1475d8
Anti-METTL6 polyclonal antibody
METTL6 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035166
(Atlas Antibodies Cat# HPA035166, RRID:AB_10602709)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQ; Manufacturer approved use: ICC-IF, IHC
5ee37f4b-98ed-57f5-8e10-74cbb03ab13e
Anti-THADA polyclonal antibody
THADA See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035192
(Atlas Antibodies Cat# HPA035192, RRID:AB_2674512)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MLCQLLPMQPVPESSDGLLTVEQVKEIGDYFKQHLLQSRHRGAFELAYTGFVKLTEVLNRCPNVSLQKLPEQWLWSVLEEIKCSDPSSKLCATR; Manufacturer approved use: IHC
f2b1bf93-e111-5acd-bfb4-d4becc354d21
Anti-KIF5C polyclonal antibody
KIF5C See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035210
(Atlas Antibodies Cat# HPA035210, RRID:AB_10671931)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELSNHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGV; Manufacturer approved use: ICC-IF, IHC, WB
8d9f0e88-96cb-5eda-a1d5-511ab3f23aaa
Anti-IKZF1 polyclonal antibody
IKZF1 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035221
(Atlas Antibodies Cat# HPA035221, RRID:AB_2674524)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKC; Manufacturer approved use: IHC
b889d876-2072-58c6-9657-3f65ba784b90
Anti-IKZF1 polyclonal antibody
IKZF1 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA035222
(Atlas Antibodies Cat# HPA035222, RRID:AB_2674525)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSH; Manufacturer approved use: ICC-IF, IHC, WB
68e73d6b-bb2b-57e3-a416-8aafb562b853