Showing 1 - 20 results out of 22,044 with the query:
*
with facets:
Vendor:Atlas Antibodies X
Antibody ID
Antibody Name
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
Anti-SOX6 antibody
SOX6 See NCBI gene human
Atlas Antibodies Go To Vendor
AMAb91382
(Atlas Antibodies Cat# AMAb91382, RRID:AB_2716662)
monoclonal antibody
CL5685
mouse
Originating manufacturer of this product; Validation data for: WB; Epitope: Synthetic Peptide; Protein A purified
Anti-IGLON5 polyclonal antibody
IGLON5
Atlas Antibodies Go To Vendor
HPA048263
(Atlas Antibodies Cat# HPA048263, RRID:AB_2630369)
polyclonal antibody
rabbit
Checked with the vendor and this does not exist Nov 1, 2016; requesting MDS
transthyretin Antibody
TTR See NCBI gene human
Atlas Antibodies Go To Vendor
AMAb90649
(Atlas Antibodies Cat# AMAb90649, RRID:AB_2665620)
monoclonal antibody
CL0290
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: IHC, WB; Epitope specificity:
laminin, beta 1 Antibody
LAMB1 See NCBI gene human
Atlas Antibodies Go To Vendor
AMAb91092
(Atlas Antibodies Cat# AMAb91092, RRID:AB_2665797)
monoclonal antibody
CL2970
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: IHC, WB; Epitope specificity:
profilin 1 Antibody
PFN1 See NCBI gene human
Atlas Antibodies Go To Vendor
AMAb91181
(Atlas Antibodies Cat# AMAb91181, RRID:AB_2665835)
monoclonal antibody
CL3524
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: IHC, WB; Epitope specificity:
lysosomal-associated membrane protein 1 Antibody
LAMP1 See NCBI gene human
Atlas Antibodies Go To Vendor
AMAb91298
(Atlas Antibodies Cat# AMAb91298, RRID:AB_2665885)
monoclonal antibody
CL4463
mouse
Originating manufacturer of this product, immunogen description: Synthetic Peptide Protein A purified; Manufacturer approved use: IHC, WB; Epitope specificity:
Anti-OTC polyclonal antibody
OTC See NCBI gene human
Atlas Antibodies Go To Vendor
HPA000570
(Atlas Antibodies Cat# HPA000570, RRID:AB_1079534)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLSSMADAVLAR; Manufacturer approved use: IHC
Anti-APOO polyclonal antibody
APOO See NCBI gene human
Atlas Antibodies Go To Vendor
HPA003187
(Atlas Antibodies Cat# HPA003187, RRID:AB_1079375)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence IKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK; Manufacturer approved use: IHC, WB
Anti-ZMPSTE24 polyclonal antibody
ZMPSTE24 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA006988
(Atlas Antibodies Cat# HPA006988, RRID:AB_1080659)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KTTTHVPPELGQIMDSETFEKSRLYQLDKSTFS; Manufacturer approved use: IHC, WB
Anti-BAMBI polyclonal antibody
BAMBI See NCBI gene human
Atlas Antibodies Go To Vendor
HPA010819
(Atlas Antibodies Cat# HPA010819, RRID:AB_2668371)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV; Manufacturer approved use: ICC-IF
Anti-NRG4 polyclonal antibody
NRG4 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA010957
(Atlas Antibodies Cat# HPA010957, RRID:AB_1079504)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTK; Manufacturer approved use: IHC
Anti-MANF polyclonal antibody
MANF See NCBI gene human
Atlas Antibodies Go To Vendor
HPA011175
(Atlas Antibodies Cat# HPA011175, RRID:AB_1845039)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence CEVCISYLGRFYQDLKDRDVTFSPATIENELIKFCREAR; Manufacturer approved use: IHC, WB
Anti-DUSP27 polyclonal antibody
DUSP27 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA012608
(Atlas Antibodies Cat# HPA012608, RRID:AB_1847895)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EALMTVRKKRAIYPNEGFLKQLRELNEKLMEER; Manufacturer approved use: IHC
Anti-TOR1B polyclonal antibody
TOR1B See NCBI gene human
Atlas Antibodies Go To Vendor
HPA013697
(Atlas Antibodies Cat# HPA013697, RRID:AB_1858196)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LDLEEKLFGQHLATEVIFKALTGFRNNKNPKKPLTLSLHGWAGTGKNFVSQIVAENLHPKGLKSNFVHLFVSTLHFPHEQKIKLYQDQLQKWIRGNVSACANSV; Manufacturer approved use: IHC, WB
Anti-HCRTR1 polyclonal antibody
HCRTR1 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA014018
(Atlas Antibodies Cat# HPA014018, RRID:AB_1854810)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWV; Manufacturer approved use: IHC
Anti-2-Mar polyclonal antibody
2-Mar See NCBI gene human
Atlas Antibodies Go To Vendor
HPA014063
(Atlas Antibodies Cat# HPA014063, RRID:AB_1853576)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV; Manufacturer approved use: IHC, WB
Anti-CD300C polyclonal antibody
CD300C See NCBI gene human
Atlas Antibodies Go To Vendor
HPA014523
(Atlas Antibodies Cat# HPA014523, RRID:AB_1846293)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR; Manufacturer approved use: IHC, WB
Anti-TMEM41B polyclonal antibody
TMEM41B See NCBI gene human
Atlas Antibodies Go To Vendor
HPA014946
(Atlas Antibodies Cat# HPA014946, RRID:AB_2205037)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGS; Manufacturer approved use: ICC-IF, IHC, WB
Anti-ACKR1 polyclonal antibody
ACKR1 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA016421
(Atlas Antibodies Cat# HPA016421, RRID:AB_1849219)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence CHQATRTLLPSLPLPEGWSSHLDTLGSKS; Manufacturer approved use: IHC
Anti-ASL polyclonal antibody
ASL See NCBI gene human
Atlas Antibodies Go To Vendor
HPA016646
(Atlas Antibodies Cat# HPA016646, RRID:AB_1845096)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDED; Manufacturer approved use: IHC, WB