Showing 1 - 20 results out of 21,341 with the query:
*
with facets:
Vendor:Atlas Antibodies X
Antibody ID
Antibody Name
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-NANOG antibody
NANOG See NCBI gene human
Atlas Antibodies
AMAb91391
(Atlas Antibodies Cat# AMAb91391, RRID:AB_2716668)
monoclonal antibody
CL5803
mouse
Originating manufacturer of this product; Validation data for: ICC-IF, IHC; Epitope: Synthetic Peptide; Protein A purified
fdaf4f94-6493-58f6-ae29-6ea84932a649
Anti-CTGF antibody
CTGF See NCBI gene human, mouse, rat
Atlas Antibodies
AMAb91366
(Atlas Antibodies Cat# AMAb91366, RRID:AB_2716654)
monoclonal antibody
CL5339
mouse
Originating manufacturer of this product; Validation data for: IHC, WB; Epitope: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence; Protein A purified
a6585356-c2b6-57a9-8a8d-f7b72aef4cbe
Anti-GRN antibody
GRN See NCBI gene human
Atlas Antibodies
AMAb91384
(Atlas Antibodies Cat# AMAb91384, RRID:AB_2716664)
monoclonal antibody
CL5692
mouse
Originating manufacturer of this product; Validation data for: IHC; Epitope: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence; Protein A purified
08ebcafa-587f-5099-af92-e24061aae2d3
Anti-CUX1 antibody
CUX1 See NCBI gene human
Atlas Antibodies
AMAb91353
(Atlas Antibodies Cat# AMAb91353, RRID:AB_2716649)
monoclonal antibody
CL5278
mouse
Originating manufacturer of this product; Validation data for: ICC-IF, IHC; Epitope: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence; Protein A purified; Binds to an epitope located within the peptide sequence VGRSGAWKDH as determined by overlapping synthetic peptides.
9a70a276-1b84-573a-a2bc-371d14cef0b6
Anti-SOX6 antibody
SOX6 See NCBI gene human
Atlas Antibodies
AMAb91383
(Atlas Antibodies Cat# AMAb91383, RRID:AB_2716663)
monoclonal antibody
CL5690
mouse
Originating manufacturer of this product; Validation data for: ICC-IF, IHC; Epitope: Synthetic Peptide; Protein A purified
e0bef317-285f-5358-ae7e-647fc1087dc5
Anti-SOX4 antibody
SOX4 See NCBI gene human, mouse, rat
Atlas Antibodies
AMAb91380
(Atlas Antibodies Cat# AMAb91380, RRID:AB_2716661)
monoclonal antibody
CL5665
mouse
Originating manufacturer of this product; Validation data for: ICC-IF, IHC; Epitope: Synthetic Peptide; Protein A purified
6b08a999-f3e2-53f6-828e-1ee5bf64e802
Anti-SOX4 antibody
SOX4 See NCBI gene human, mouse, rat
Atlas Antibodies
AMAb91378
(Atlas Antibodies Cat# AMAb91378, RRID:AB_2716660)
monoclonal antibody
CL5634
mouse
Originating manufacturer of this product; Validation data for: ICC-IF, IHC; Epitope: Synthetic Peptide; Protein A purified
58c965b3-7628-50c7-b34e-93caecd8c967
Anti-TBX19 antibody
TBX19 See NCBI gene human
Atlas Antibodies
AMAb91409
(Atlas Antibodies Cat# AMAb91409, RRID:AB_2716678)
monoclonal antibody
CL6251
mouse
Originating manufacturer of this product; Validation data for: IHC; Epitope: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence; Protein A purified; Binds to an epitope located within the peptide sequence VLGEPSLTSIAVSTW as determined by overlapping synthetic peptides.
194ab39a-33f2-5b5e-86e6-806dfd4d0206
Anti-ROR2 antibody
ROR2 See NCBI gene human
Atlas Antibodies
AMAb91402
(Atlas Antibodies Cat# AMAb91402, RRID:AB_2716674)
monoclonal antibody
CL5950
mouse
Originating manufacturer of this product; Validation data for: ICC-IF, IHC; Epitope: Synthetic Peptide; Protein A purified
c6bf4fbc-2634-5c6b-b3d6-7aecc9e809cb
Anti-IGLON5 polyclonal antibody
IGLON5
Atlas Antibodies
HPA048263
(Atlas Antibodies Cat# HPA048263, RRID:AB_2630369)
polyclonal antibody
rabbit
Checked with the vendor and this does not exist Nov 1, 2016; requesting MDS
fdef4636-b08e-5ef2-a521-a80ff2981c91
Anti-MPPED2 polyclonal antibody
MPPED2 See NCBI gene human
Atlas Antibodies
HPA062575
(Atlas Antibodies Cat# HPA062575, RRID:AB_2684797)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MAHGIPSQGKVTITVDEYSS; Manufacturer approved use: ICC-IF
8ff3aaf0-ebc7-565d-be48-c92535230030
fibrillin 1 Antibody
FBN1 See NCBI gene human
Atlas Antibodies
AMAb90585
(Atlas Antibodies Cat# AMAb90585, RRID:AB_2665597)
monoclonal antibody
CL0226
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: IHC; Epitope specificity: Binds to an epitope located within the peptide sequence KMQCCCDAGRCWSPG as determined by overlapping synthetic peptides.
cd4b6f1f-89f1-5b21-95cd-12886f293dd6
protein tyrosine phosphatase, receptor type, C Antibody
CD45 See NCBI gene human
Atlas Antibodies
AMAb90519
(Atlas Antibodies Cat# AMAb90519, RRID:AB_2665572)
monoclonal antibody
CL0160
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: IHC, WB; Epitope specificity: Binds to an epitope located within the peptide sequence LNLDKNLIKY as determined by overlapping synthetic peptides.
9f8db8c6-39ca-500c-ae6c-98c091672a1f
Anti-NDFIP1 polyclonal antibody
NDFIP1 See NCBI gene human
Atlas Antibodies
HPA009682
(Atlas Antibodies Cat# HPA009682, RRID:AB_1079455)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKP; Manufacturer approved use: IHC, WB
749f0a0b-5305-5434-b6f2-fac7ff03e6db
apolipoprotein L, 1 Antibody
APOL1 See NCBI gene human
Atlas Antibodies
AMAb90530
(Atlas Antibodies Cat# AMAb90530, RRID:AB_2665576)
monoclonal antibody
CL0171
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: IHC, WB; Epitope specificity: Binds to an epitope located within the peptide sequence AEELKKVAQELEEKL as determined by overlapping synthetic peptides.
328c0514-b90d-50ff-b47d-d75e4b0a6611
arginase, liver Antibody
ARG1 See NCBI gene human
Atlas Antibodies
AMAb90545
(Atlas Antibodies Cat# AMAb90545, RRID:AB_2665582)
monoclonal antibody
CL0186
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: IHC, WB; Epitope specificity: Binds to an epitope located within the peptide sequence KGQPRGGVEE as determined by overlapping synthetic peptides.
f214d202-e0cb-5fbd-a423-a2bf64e887fb
ribonuclease, RNase A family, 7 Antibody
RNASE7 See NCBI gene human
Atlas Antibodies
AMAb90583
(Atlas Antibodies Cat# AMAb90583, RRID:AB_2665595)
monoclonal antibody
CL0224
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: IHC, WB; Epitope specificity: Binds to an epitope located within the peptide sequence KGMTSSQWFKIQHMQ as determined by overlapping synthetic peptides.
7d43b6e3-67e7-5f62-b7c8-97fb30ca9983
runt-related transcription factor 2 Antibody
RUNX2 See NCBI gene human
Atlas Antibodies
AMAb90591
(Atlas Antibodies Cat# AMAb90591, RRID:AB_2665598)
monoclonal antibody
CL0232
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: IHC, WB; Epitope specificity: Binds to an epitope located within the peptide sequence VPRRISGASELGPFS as determined by overlapping synthetic peptides.
4e42b80c-e268-5eca-a1b2-f88fd5b1d56e
methyltransferase like 14 Antibody
METTL14 See NCBI gene human
Atlas Antibodies
AMAb91276
(Atlas Antibodies Cat# AMAb91276, RRID:AB_2665878)
monoclonal antibody
CL4254
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: IHC, WB; Epitope specificity:
e818f025-64f0-5243-8016-e469dfeb8eab
acyl-CoA synthetase long-chain family member 5 Antibody
ACSL5 See NCBI gene human
Atlas Antibodies
AMAb90634
(Atlas Antibodies Cat# AMAb90634, RRID:AB_2665614)
monoclonal antibody
CL0275
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: IHC, WB; Epitope specificity: Binds to an epitope located within the peptide sequence MDPFDDDLKQ as determined by overlapping synthetic peptides.
8e642c72-c7c4-51d4-8a21-fce21f4ddfcc