Showing 1 - 20 results out of 21,341 with the query:
*
with facets:
Vendor:Atlas Antibodies X
Antibody ID
Antibody Name
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
tyrosine hydroxylase Antibody
TH See NCBI gene human, rat, mouse
Atlas Antibodies Go To Vendor
AMAb91112
(Atlas Antibodies Cat# AMAb91112, RRID:AB_2665805)
monoclonal antibody
CL3049
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: IHC; Epitope specificity:
b178050e-1f60-5abf-8526-01e7e533ebf1
Anti-STOM polyclonal antibody
STOM See NCBI gene human
Atlas Antibodies Go To Vendor
HPA010961
(Atlas Antibodies Cat# HPA010961, RRID:AB_1080111)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence AEKRHTRDSEAQRLPDSFKDSPSKGLGPCG; Manufacturer approved use: ICC-IF, IHC, WB
77c683c6-4b10-508c-a7f0-7b35f85e8398
Anti-RHO polyclonal antibody
RHO See NCBI gene human
Atlas Antibodies Go To Vendor
HPA013440
(Atlas Antibodies Cat# HPA013440, RRID:AB_2668844)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFS; Manufacturer approved use: IHC
043d94d7-a280-549c-9019-2bedd7cdaf12
Anti-TSPAN3 polyclonal antibody
TSPAN3 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA015996
(Atlas Antibodies Cat# HPA015996, RRID:AB_1858406)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKKLQEI; Manufacturer approved use: IHC
e7c6ad8c-fff9-50ac-9566-caca41efeac9
Anti-ARPC5L polyclonal antibody
ARPC5L See NCBI gene human
Atlas Antibodies Go To Vendor
HPA022013
(Atlas Antibodies Cat# HPA022013, RRID:AB_1845045)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV; Manufacturer approved use: IHC
19f749c3-edd6-5ffc-8248-cf8fa0f7e13f
Anti-CMTM4 polyclonal antibody
CMTM4 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA023890
(Atlas Antibodies Cat# HPA023890, RRID:AB_1847007)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYL; Manufacturer approved use: IHC, WB
453e1233-0b08-5f17-b3c2-675c15262c96
Anti-TMEM144 polyclonal antibody
TMEM144 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA043767
(Atlas Antibodies Cat# HPA043767, RRID:AB_10964491)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence CSMDTTPLITEHVINTTQDPCSWVDKLSTVHHRI; Manufacturer approved use: IHC
b6fd3ba2-be03-5d90-8436-373d442f1185
Anti-RGN polyclonal antibody
RGN See NCBI gene human
Atlas Antibodies Go To Vendor
HPA029102
(Atlas Antibodies Cat# HPA029102, RRID:AB_10599846)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMC; Manufacturer approved use: ICC-IF, IHC, WB
779634a8-22ef-50bf-b38e-b111a7c52993
Anti-MTURN polyclonal antibody
MTURN See NCBI gene human
Atlas Antibodies Go To Vendor
HPA029507
(Atlas Antibodies Cat# HPA029507, RRID:AB_10601149)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MDFQQLADVAEKWCSNTPFELIATEETERRMDFYADPGVSFYVLCPDNGCGDN; Manufacturer approved use: ICC-IF, IHC
af094834-4fec-5500-8622-d363dd2233b5
Anti-OAZ3 polyclonal antibody
OAZ3 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA030136
(Atlas Antibodies Cat# HPA030136, RRID:AB_2673331)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VNFQNDRNDRGALLRAFSYMGFEVVRPDHPALPPLDNVIFMVYPLERDVGHLPSEPP; Manufacturer approved use: ICC-IF
87aa3e7a-8794-5157-be38-856fd7c31a01
Anti-SLC2A12 polyclonal antibody
SLC2A12 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA031593
(Atlas Antibodies Cat# HPA031593, RRID:AB_10600810)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PSPRFLVMKGQEGAASKVLGRLRALSDTTEELTVIKSSLKDEYQYSFWDLFRSKDNMRTR; Manufacturer approved use: ICC-IF, IHC
9bb2c345-fd92-5524-b3b4-6ded49f2015f
Anti-CT45A1 polyclonal antibody
CT45A1 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA044757
(Atlas Antibodies Cat# HPA044757, RRID:AB_2679075)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI; Manufacturer approved use: IHC
24b793cc-d444-5ea0-8e04-fb8ad7385409
Anti-TUB polyclonal antibody
TUB See NCBI gene human
Atlas Antibodies Go To Vendor
HPA049019
(Atlas Antibodies Cat# HPA049019, RRID:AB_2680601)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LPSFWVSFFAETGILFPGGTPWPMGSQHSKQHRKPGPLKRGHRRDRRTTRRKYWKEGREI; Manufacturer approved use: IHC
3ef650de-67f5-5b09-8153-d0ba4463f56e
Anti-ORAI2 polyclonal antibody
ORAI2 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA065937
(Atlas Antibodies Cat# HPA065937, RRID:AB_2685581)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence IKFLPVDARRQPGPPPGPGSHTGW; Manufacturer approved use: IHC
2ae613e9-555e-57d7-826a-7ace958698a3
chromogranin A (parathyroid secretory protein 1) Antibody
CHGA See NCBI gene human
Atlas Antibodies Go To Vendor
AMAb90525
(Atlas Antibodies Cat# AMAb90525, RRID:AB_2665574)
monoclonal antibody
CL0166
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: IHC, WB; Epitope specificity: Binds to an epitope located within the peptide sequence HSGFEDELSEVLENQ as determined by overlapping synthetic peptides.
e3d1b5da-3eb9-5cce-b5d5-fdab51565877
SIX homeobox 1 Antibody
SIX1 See NCBI gene human
Atlas Antibodies Go To Vendor
AMAb90544
(Atlas Antibodies Cat# AMAb90544, RRID:AB_2665581)
monoclonal antibody
CL0185
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: ICC-IF, IHC, WB; Epitope specificity:
efee0744-f5fb-576a-83cf-960b31552059
nestin Antibody
NES See NCBI gene human
Atlas Antibodies Go To Vendor
AMAb90556
(Atlas Antibodies Cat# AMAb90556, RRID:AB_2665584)
monoclonal antibody
CL0197
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: IHC, WB; Epitope specificity: Binds to an epitope located within the peptide sequence VGGLGDPGHL as determined by overlapping synthetic peptides.
3cdefa7e-f4c2-5012-9c1f-7cd3e2f8f6d5
NLR family, pyrin domain containing 3 Antibody
NLRP3 See NCBI gene human
Atlas Antibodies Go To Vendor
AMAb90569
(Atlas Antibodies Cat# AMAb90569, RRID:AB_2665589)
monoclonal antibody
CL0210
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: WB; Epitope specificity: Binds to an epitope located within the peptide sequence EKAKRDEPKW as determined by overlapping synthetic peptides.
1384c13d-accf-5af0-9aca-bdee2b4f34d3
solute carrier family 27 (fatty acid transporter), member 5 Antibody
SLC27A5 See NCBI gene human
Atlas Antibodies Go To Vendor
AMAb90572
(Atlas Antibodies Cat# AMAb90572, RRID:AB_2665590)
monoclonal antibody
CL0213
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: IHC, WB; Epitope specificity: Binds to an epitope located within the peptide sequence RCFYLSHTSP as determined by overlapping synthetic peptides.
ddd67fa3-167c-5eb0-9ec5-206473dd691f
solute carrier family 27 (fatty acid transporter), member 5 Antibody
SLC27A5 See NCBI gene human
Atlas Antibodies Go To Vendor
AMAb90574
(Atlas Antibodies Cat# AMAb90574, RRID:AB_2665591)
monoclonal antibody
CL0215
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: IHC, WB; Epitope specificity: Binds to an epitope located within the peptide sequence ESLEEILPKL as determined by overlapping synthetic peptides.
d5df9f43-3cb6-500a-8db9-3ac4def57539