Showing 1 - 20 results out of 22,044 with the query:
*
with facets:
Vendor:Atlas Antibodies X
Antibody ID
Antibody Name
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
Anti-GPR4 polyclonal antibody
GPR4 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA014278
(Atlas Antibodies Cat# HPA014278, RRID:AB_1849300)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DELFRDRYNHTFCFEKFPMEGWVAWMN; Manufacturer approved use: IHC
f651e62d-b58b-5e40-8956-43327a1b55fd
Anti-CCR6 polyclonal antibody
CCR6 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA014488
(Atlas Antibodies Cat# HPA014488, RRID:AB_1846639)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KYNTQGSDVCEPKYQTVSEPIRWKLLML; Manufacturer approved use: IHC
14b5577c-34db-5f75-90dc-1a38b0f74037
Anti-OR10G3 polyclonal antibody
OR10G3 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA019766
(Atlas Antibodies Cat# HPA019766, RRID:AB_1854780)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MERINSTLLTAFILTGIPYPLRLRTLF; Manufacturer approved use: IHC
f5db4410-a49e-50bc-a4c5-1132489baf2b
Anti-IL1R1 polyclonal antibody
IL1R1 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA029560
(Atlas Antibodies Cat# HPA029560, RRID:AB_2673094)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCGYKLF; Manufacturer approved use: IHC
a7d2b9c5-c9bf-5bca-a9e9-fa6478419036
Anti-SLC35B2 polyclonal antibody
SLC35B2 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA029638
(Atlas Antibodies Cat# HPA029638, RRID:AB_10602402)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT; Manufacturer approved use: IHC
7c98eec8-958b-5134-b44a-4fffa24c56e7
Anti-TECR polyclonal antibody
TECR See NCBI gene human
Atlas Antibodies Go To Vendor
HPA029780
(Atlas Antibodies Cat# HPA029780, RRID:AB_10603348)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TQMTIWAKGKHRSYLKEFRDYPPLRMPII; Manufacturer approved use: IHC
c288c754-1c83-5a70-9a88-4ad59128534f
Anti-UPK1B polyclonal antibody
UPK1B See NCBI gene human
Atlas Antibodies Go To Vendor
HPA031799
(Atlas Antibodies Cat# HPA031799, RRID:AB_10671579)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence FTPNLFLKQMLERYQNNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDW; Manufacturer approved use: IHC
25f1a936-f6a2-5f3a-bb52-fc5bd0ca9143
Anti-COA3 polyclonal antibody
COA3 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA031966
(Atlas Antibodies Cat# HPA031966, RRID:AB_10602115)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ISQERFLDELEDEAKAARARALARASGS; Manufacturer approved use: ICC-IF, IHC, WB
86eb48bf-890d-5674-b0f7-61d866334801
Anti-HBA1 polyclonal antibody
HBA1 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA043780
(Atlas Antibodies Cat# HPA043780, RRID:AB_2678667)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSF; Manufacturer approved use: IHC, WB
b07b3c55-c765-532f-a5cc-ad09e507c74f
Anti-OR5T3 polyclonal antibody
OR5T3 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA044986
(Atlas Antibodies Cat# HPA044986, RRID:AB_10963548)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence STFTGYNLYNLQVKTEMDKLSSGLDIYRNPLKNKTEVTMF; Manufacturer approved use: IHC
50363221-53f3-5d97-b514-f7477288e578
Anti-UGT2B4 polyclonal antibody
UGT2B4 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA045108
(Atlas Antibodies Cat# HPA045108, RRID:AB_2679218)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence FVGGLHCKPAKPLPKEMEEFVQSSG; Manufacturer approved use: IHC
6b4ed209-5913-5006-b8cb-f0085bcd847c
Anti-SPPL2B polyclonal antibody
SPPL2B See NCBI gene human
Atlas Antibodies Go To Vendor
HPA039292
(Atlas Antibodies Cat# HPA039292, RRID:AB_2676429)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YWAGSRDVKKRYMKHKRDDGPEKQEDEAVDV; Manufacturer approved use: ICC-IF, WB
1f9e2934-4068-5173-82a9-a62656aaf9e7
Anti-IPO5 polyclonal antibody
IPO5 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA040983
(Atlas Antibodies Cat# HPA040983, RRID:AB_2677236)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence AAEQQQFYLLLGNLLSPDNVVRKQAEETYEN; Manufacturer approved use: IHC
a05d42a4-545c-557d-8035-fd88a3bae113
profilin 1 Antibody
PFN1 See NCBI gene human
Atlas Antibodies Go To Vendor
AMAb91181
(Atlas Antibodies Cat# AMAb91181, RRID:AB_2665835)
monoclonal antibody
CL3524
mouse
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence Protein A purified; Manufacturer approved use: IHC, WB; Epitope specificity:
b4f0ce78-a73e-599f-8da6-68f2b0c6264c
Anti-GFRA2 polyclonal antibody
GFRA2 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA024704
(Atlas Antibodies Cat# HPA024704, RRID:AB_1849629)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCR; Manufacturer approved use: IHC, WB
2ee68c3c-f31e-5386-818e-fbeea2809882
Anti-TIMM17B polyclonal antibody
TIMM17B See NCBI gene human
Atlas Antibodies Go To Vendor
HPA029093
(Atlas Antibodies Cat# HPA029093, RRID:AB_10600913)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH; Manufacturer approved use: IHC, WB
588ecdc8-b590-5d81-8223-3829c8e9bbb2
Anti-OAZ3 polyclonal antibody
OAZ3 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA030136
(Atlas Antibodies Cat# HPA030136, RRID:AB_2673331)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VNFQNDRNDRGALLRAFSYMGFEVVRPDHPALPPLDNVIFMVYPLERDVGHLPSEPP; Manufacturer approved use: ICC-IF
87aa3e7a-8794-5157-be38-856fd7c31a01
Anti-SLC2A12 polyclonal antibody
SLC2A12 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA031593
(Atlas Antibodies Cat# HPA031593, RRID:AB_10600810)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PSPRFLVMKGQEGAASKVLGRLRALSDTTEELTVIKSSLKDEYQYSFWDLFRSKDNMRTR; Manufacturer approved use: ICC-IF, IHC
9bb2c345-fd92-5524-b3b4-6ded49f2015f
Anti-LY86 polyclonal antibody
LY86 See NCBI gene human
Atlas Antibodies Go To Vendor
HPA044895
(Atlas Antibodies Cat# HPA044895, RRID:AB_2679138)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQVLLELYTEKRSTVACANATIMC; Manufacturer approved use: IHC
fdf0ec25-3e15-5ee5-9c19-cce2f35f0d8f
Anti-TUB polyclonal antibody
TUB See NCBI gene human
Atlas Antibodies Go To Vendor
HPA049019
(Atlas Antibodies Cat# HPA049019, RRID:AB_2680601)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LPSFWVSFFAETGILFPGGTPWPMGSQHSKQHRKPGPLKRGHRRDRRTTRRKYWKEGREI; Manufacturer approved use: IHC
3ef650de-67f5-5b09-8153-d0ba4463f56e