Showing 1 - 20 results out of 21,310 with the query:
*
with facets:
Vendor:Atlas Antibodies X
Antibody ID
Antibody Name
Cat Num
Proper Citation
Reference
Clone ID
Host Organism
Comments
v_uuid
keratin 1 Antibody
KRT1 See NCBI gene human
Atlas Antibodies
HPA017917
(Atlas Antibodies Cat# HPA017917, RRID:AB_1852192)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MSRQFSSRSGYRSGGGFSSGSAGIINYQRRTTSSSTRRSGGGGGRFSSCGGGGGSFGA; Manufacturer approved use: IHC
dfaac840-90d2-52b1-87a8-3f058a7f6382
deleted in azoospermia-like Antibody
DAZL See NCBI gene human
Atlas Antibodies
HPA019593
(Atlas Antibodies Cat# HPA019593, RRID:AB_1847494)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECS; Manufacturer approved use: IHC, WB
82382a8e-fe22-5712-a114-55e6ea0967fb
discs, large homolog 2 (Drosophila) Antibody
DLG2 See NCBI gene human
Atlas Antibodies
HPA023896
(Atlas Antibodies Cat# HPA023896, RRID:AB_2671353)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ETDETTTKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSQI; Manufacturer approved use: ICC-IF, WB
f2de1c42-b203-568a-94a7-2d0aa7419972
transmembrane protein 87A Antibody
TMEM87A See NCBI gene human
Atlas Antibodies
HPA018189
(Atlas Antibodies Cat# HPA018189, RRID:AB_2205198)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TTIFLKFDGEPCDLSLNITWYLKSADCYNEIYNFKAEEVELYLEKLKEKRGLSGKYQTSSKLFQNCSELFKTQTFSGDFMHRLPLLGEKQEAKENGTN; Manufacturer approved use: ICC-IF, IHC
c5bfe06d-2fef-5813-b9ec-4fc3d43e6891
TRK-fused gene Antibody
TFG See NCBI gene human
Atlas Antibodies
HPA019473
(Atlas Antibodies Cat# HPA019473, RRID:AB_1857936)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPG; Manufacturer approved use: ICC-IF, IHC
6f21f4aa-8bb3-5a53-b463-58de2a8b1781
basic leucine zipper and W2 domains 2 Antibody
BZW2 See NCBI gene human
Atlas Antibodies
HPA026709
(Atlas Antibodies Cat# HPA026709, RRID:AB_10600752)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLEL; Manufacturer approved use: ICC-IF, IHC, WB
710b6d52-6dec-5cb7-a430-0d791f4f07ec
sperm acrosome associated 1 Antibody
SPACA1 See NCBI gene human
Atlas Antibodies
HPA026744
(Atlas Antibodies Cat# HPA026744, RRID:AB_2194642)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence REVILTNGCPGGESKCVVRVEECRGPTDCGWGKPISESLESVRLACIHTSPLNRFKYMWKL; Manufacturer approved use: IHC
03e12d33-ed84-5c7c-9752-d6e73d70d45d
family with sequence similarity 221, member A Antibody
FAM221A See NCBI gene human
Atlas Antibodies
HPA026752
(Atlas Antibodies Cat# HPA026752, RRID:AB_1853912)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MERLTLPLGGAAAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKRKVLPLRLQNRLFVSWRSPTGMDCKLVGPET; Manufacturer approved use: ICC-IF, IHC, WB
7e74c3e9-45bb-5384-a738-a6809508bdc2
Yip1 domain family, member 7 Antibody
YIPF7 See NCBI gene human
Atlas Antibodies
HPA030642
(Atlas Antibodies Cat# HPA030642, RRID:AB_10601027)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LTVLNPMKPVDGSIMNETDLTGPILFCVALGATLLLAG; Manufacturer approved use: IHC
62c55458-d00c-5580-bb1c-c7d442dd7689
guanine nucleotide binding protein-like 3 (nucleolar) Antibody
GNL3 See NCBI gene human
Atlas Antibodies
HPA036742
(Atlas Antibodies Cat# HPA036742, RRID:AB_2675282)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KQQQKLDRQKELEKKRKLETNPDIKPSNVEPMEKEFGLCKTENKAKSGKQNSKKLYCQELKKVIEASDVVLE; Manufacturer approved use: IHC, WB
90bc9e0a-b11e-5118-a522-4d121441cad2
glutamine-rich 1 Antibody
QRICH1 See NCBI gene human
Atlas Antibodies
HPA037678
(Atlas Antibodies Cat# HPA037678, RRID:AB_2675603)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MNNSLENTISFEEYIRVKARSVPQHRMKEFLDSLASKGPEALQEFQQTATTTMVYQQGGNCIYTDSTEVAGSLLELACPVTTSVQPQTQQEQQIQV; Manufacturer approved use: ICC-IF, IHC, WB
2d66e7ab-b2f6-551e-adee-e12ca3aa4320
poly(rC) binding protein 2 Antibody
PCBP2 See NCBI gene human
Atlas Antibodies
HPA038356
(Atlas Antibodies Cat# HPA038356, RRID:AB_10697248)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence IFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEG; Manufacturer approved use: ICC-IF, IHC
ad8f193c-fcfe-52d9-ad88-287729723263
lymphocyte antigen 6 complex, locus G5C Antibody
LY6G5C See NCBI gene human
Atlas Antibodies
HPA038690
(Atlas Antibodies Cat# HPA038690, RRID:AB_10673286)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ADLPSCWGAGPCYTGHKVGALRRDTVICCCRHGDYSTPCLFTPGKPSRNPSPWKRTLWT; Manufacturer approved use: ICC-IF, IHC
f87cbc52-cdc5-582d-a8ce-7cd21d0945f0
Bardet-Biedl syndrome 2 Antibody
BBS2 See NCBI gene human
Atlas Antibodies
HPA041315
(Atlas Antibodies Cat# HPA041315, RRID:AB_10960892)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence IVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMDG; Manufacturer approved use: IHC
9daaffac-0842-5a4e-b89a-9c627d10a972
exosome component 9 Antibody
EXOSC9 See NCBI gene human
Atlas Antibodies
HPA041838
(Atlas Antibodies Cat# HPA041838, RRID:AB_10794492)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence CVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSVQGDEVTLYTPEERDPVPLSIHHMPICVSFA; Manufacturer approved use: ICC-IF, IHC
84a79f37-7154-54d9-8a84-3c00e934f3d9
biliverdin reductase A Antibody
BLVRA See NCBI gene human
Atlas Antibodies
HPA042865
(Atlas Antibodies Cat# HPA042865, RRID:AB_10797024)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVL; Manufacturer approved use: IHC, WB
ba1c2b34-c090-5bee-87f1-0b9bbbf599b7
orosomucoid 1 Antibody
ORM1 See NCBI gene human
Atlas Antibodies
HPA046438
(Atlas Antibodies Cat# HPA046438, RRID:AB_2679666)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SDVVYTDWKKDKCEPLEKQHEKERKQEE; Manufacturer approved use: IHC
b72fdee5-2659-5b6e-9803-aaa63be81c4b
myeloid-associated differentiation marker-like 2 Antibody
MYADML2 See NCBI gene human
Atlas Antibodies
HPA048476
(Atlas Antibodies Cat# HPA048476, RRID:AB_2680410)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MGSTMEPPGGAYLHLGAVTS; Manufacturer approved use: IHC
a12b7a1c-d276-5c63-b9a9-19b88b1c2e00
LIM domain 7 Antibody
LMO7 See NCBI gene human
Atlas Antibodies
HPA050184
(Atlas Antibodies Cat# HPA050184, RRID:AB_2681045)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QLASSLSSQKEVAATEEDVTRLPSPTSPFSSLSQDQAATSKATLSSTSGLDLMSESGEGEISPQREVSRSQDQFSDMRISINQTPGKSLDFGFTIKWDIPGIFVASVEAGSPAEFSQLQVDDEIIAINNTKFSYNDSKEWEEA; Manufacturer approved use: ICC-IF
54c92acc-b84e-56ec-bfd5-e3961aee335a
solute carrier family 35, member F2 Antibody
SLC35F2 See NCBI gene human
Atlas Antibodies
HPA050695
(Atlas Antibodies Cat# HPA050695, RRID:AB_2681217)
polyclonal antibody
rabbit
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWN; Manufacturer approved use: ICC-IF, WB
7e2763c6-8359-53ca-a05a-c14e505f3ffd