Showing 1 - 20 results out of 878 with the query:
*
with facets:
Vendor:UC Davis/NIH NeuroMab Facility X
Kir2.4 K+ channel antibody
KCNJ14 mouse
UC Davis/NIH NeuroMab Facility Go To Vendor
73-471
(UC Davis/NIH NeuroMab Facility Cat# 73-471, RRID:AB_2637016)
monoclonal antibody
N465/11
mouse
originating manufacturer of this product
04710f8e-77e1-5b9d-ad7c-ede1cd06da30
Cavbeta3 Ca2+ channel antibody
CACNB3 human
UC Davis/NIH NeuroMab Facility Go To Vendor
73-472
(UC Davis/NIH NeuroMab Facility Cat# 73-472, RRID:AB_2637017)
monoclonal antibody
N473/36
mouse
originating manufacturer of this product
d1869730-52d6-5cfc-8b06-c8735a577740
Mad3 antibody
Mad3 null
UC Davis/NIH NeuroMab Facility Go To Vendor
73-250
(UC Davis/NIH NeuroMab Facility Cat# 73-250, RRID:AB_11030250)
monoclonal antibody
N129/15
Originating Manufacturer; manufacturer recommendations: IgG2b ICC
1c057cce-3bcf-50e6-a3cf-bc753863203f
Neuroligin-4* antibody
Neuroligin-4* mouse
UC Davis/NIH NeuroMab Facility Go To Vendor
75-141
(UC Davis/NIH NeuroMab Facility Cat# 75-141, RRID:AB_11030369)
monoclonal antibody
null
Originating Manufacturer; manufacturer recommendations: IgG1 ICC, IB
1b071ad3-a8e5-5eec-9f27-be469672f010
ASIC1 ion channel antibody
ASIC1 ion channel rat, mouse, rat
UC Davis/NIH NeuroMab Facility Go To Vendor
75-277
(UC Davis/NIH NeuroMab Facility Cat# 75-277, RRID:AB_11030370)
monoclonal antibody
null
Originating Manufacturer; manufacturer recommendations: IgG1 ICC, IB, IHC, KO
c1b47caf-1619-5ca6-89d6-ef3b5d0014b9
Synaptotagmin-7 antibody
Synaptotagmin-7 mouse, rat, mouse, rat
UC Davis/NIH NeuroMab Facility Go To Vendor
75-265
(UC Davis/NIH NeuroMab Facility Cat# 75-265, RRID:AB_11030371)
monoclonal antibody
null
Originating Manufacturer; manufacturer recommendations: IgG2b ICC, IB, IHC
ddadb697-fa75-5fba-86ad-97127afbb04d
NCKX4 antibody
UC Davis/NIH NeuroMab Facility Go To Vendor
73-404
(UC Davis/NIH NeuroMab Facility Cat# 73-404, RRID:AB_2491078)
monoclonal antibody
N414/25
mouse
Originating Manufacturer
3591c5fe-2ac9-5c41-a135-e9adffec179e
Calbindin antibody
CALB1
UC Davis/NIH NeuroMab Facility Go To Vendor
73-448
(UC Davis/NIH NeuroMab Facility Cat# 73-448, RRID:AB_2619740)
monoclonal antibody
L109/57
mouse
Originating Manufacturer
0a96a437-18b4-5f4a-9a86-cbb94017a24c
Nav1.2 antibody
UC Davis/NIH NeuroMab Facility
K69/3
(UC Davis/NIH NeuroMab Facility Cat# K69/3, RRID:AB_2314861)
monoclonal antibody
Originating Manufacturer
8014aab4-d4bb-565c-ab95-f7fbc18fedac
MAP3K12 antibody
Fusion protein amino acids 727-888 (C-terminus) of mouse MAP3K12 mouse, rat
UC Davis/NIH NeuroMab Facility Go To Vendor
73-355
(UC Davis/NIH NeuroMab Facility Cat# 73-355, RRID:AB_2315887)
monoclonal antibody
N377/20
mouse
Originating Manufacturer; Antigen Specie:Mouse; Applications:IB, ICC, IHC
baab387d-d912-5d2f-9b0a-1956a17534b5
Ankyrin-G (staining) antibody
Fusion protein human, mouse, rat
UC Davis/NIH NeuroMab Facility Go To Vendor
73-342
(UC Davis/NIH NeuroMab Facility Cat# 73-342, RRID:AB_2315803)
monoclonal antibody
N106/43
mouse
Originating Manufacturer; Antigen Specie:Human; Applications:ICC, IHC
a20b2f19-7f3d-508d-a389-7b82375f413d
BAF53a antibody
Fusion protein amino acids 43-119 (MVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHP, actin subdomain 2) of human BAF53a human, mouse, rat
UC Davis/NIH NeuroMab Facility Go To Vendor
75-330
(UC Davis/NIH NeuroMab Facility Cat# 75-330, RRID:AB_2315809)
monoclonal antibody
N336B/83
mouse
Originating Manufacturer; Antigen Specie:Human; Applications:ICC, IB
a052cd1c-42c5-5cf9-9fbd-dd74ee6e80a9
BAF53b antibody
Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b human, mouse, rat
UC Davis/NIH NeuroMab Facility Go To Vendor
75-311
(UC Davis/NIH NeuroMab Facility Cat# 75-311, RRID:AB_2315811)
monoclonal antibody
N332B/15
mouse
Originating Manufacturer; Antigen Specie:Human; Applications:ICC, IB, IHC
193d01ec-d2b7-5adb-a0f0-55b318ed17be
Beta4-spectrin antibody
Fusion protein amino acids 1621-1832 (C-terminal repeats 14 to 15) of human Beta4-spectrin human, mouse, rat
UC Davis/NIH NeuroMab Facility Go To Vendor
73-377
(UC Davis/NIH NeuroMab Facility Cat# 73-377, RRID:AB_2315817)
monoclonal antibody
N393/76
mouse
Originating Manufacturer; Antigen Specie:Human; Applications:ICC, IB, IHC
cda273d0-68a9-574b-b7f7-80004a2813be
Beta4-spectrin antibody
Fusion protein amino acids 1621-1832 (C-terminal repeats 14 to 15) of human Beta4-spectrin human, mouse, rat
UC Davis/NIH NeuroMab Facility Go To Vendor
75-377
(UC Davis/NIH NeuroMab Facility Cat# 75-377, RRID:AB_2315818)
monoclonal antibody
N393/76
mouse
Originating Manufacturer; Antigen Specie:Human; Applications:ICC, IB, IHC
1767b4e2-c24a-56d1-bc5c-3a0cf2d14cb0
Kv2.2 potassium channel antibody
Fusion protein amino acids 716-906 (cytoplasmic C-terminus) of rat Kv2.2 long isoform mouse, rat
UC Davis/NIH NeuroMab Facility Go To Vendor
73-358
(UC Davis/NIH NeuroMab Facility Cat# 73-358, RRID:AB_2315865)
monoclonal antibody
N372C/51
mouse
Originating Manufacturer; Antigen Specie:Rat; Applications:ICC, IB, IHC
bce5ac5a-5bda-5e72-9d9b-d9bbd8e102e9
GABA(A)R, Beta2/3 antibody
Fraction of bovine brain GABA-A receptor affinity purified against immobilized benzodiazepine Ro7-1986/1 (1988 de Blas et al J Neurosci PMID 2828565, 1988 Vitorica et al J Neurosci PMID 2828566). Target initially identified as a GABA-A receptor by: (1) rat brain immunocytochemistry staining pattern via light microscopy identical to that seen via ligand autoradiography with 3H-muscimol, (2) immunoprecipitation of 3H-muscimol-binding activity of the purified receptor complex and (3) recognition of ~57 kDa protein in immunoblots against crude rat brain membrane fractions. Binding epitope identified to be within amino acids 26-40 (QSVNDPGNMSFVKET, extracellular N-terminus, 1992 Ewert et al Brain Res, PMID 1377081) of human GABA-A-R-Beta3 (also known as Gamma-aminobutyric acid receptor subunit beta-3 mouse, rat, human, bovine, chicken
UC Davis/NIH NeuroMab Facility Go To Vendor
73-363
(UC Davis/NIH NeuroMab Facility Cat# 73-363, RRID:AB_2315837)
monoclonal antibody
62-3G1
mouse
Originating Manufacturer; Antigen Specie:Bovine; Applications:ICC, IB, IHC, IP, Immuno-Gold EM
40e76aa7-b798-591c-8f92-05aa8fa1c091
GluA1/GluN1 glutamate receptor antibody
Fusion protein amino acids 1-389 (extracellular N-terminus) of rat GluA1/GluR mouse, rat
UC Davis/NIH NeuroMab Facility Go To Vendor
73-327
(UC Davis/NIH NeuroMab Facility Cat# 73-327, RRID:AB_2315839)
monoclonal antibody
N355/1
mouse
Originating Manufacturer; Antigen Specie:Rat; Applications:ICC, IB, IHC
470b5b77-ab8a-528d-827a-8e5f89fea581
GluN2A/NR2A glutamate receptor antibody
Fusion protein amino acids 75-325, extracellular N-terminus of rat NR2A human, mouse, rat
UC Davis/NIH NeuroMab Facility Go To Vendor
75-288
(UC Davis/NIH NeuroMab Facility Cat# 75-288, RRID:AB_2315842)
monoclonal antibody
N327/95
mouse
Originating Manufacturer; Antigen Specie:Rat; Applications:ICC, IB, IHC
0bf8a1bd-3352-5f18-8a6f-16b9cecc1040
LRRK1 antibody
Fusion protein amino acids 1695-2015 (C-terminus) of human LRRK1 human, mouse
UC Davis/NIH NeuroMab Facility Go To Vendor
75-347
(UC Davis/NIH NeuroMab Facility Cat# 75-347, RRID:AB_2315880)
monoclonal antibody
N341/12
mouse
Originating Manufacturer; Antigen Specie:Human; Applications:ICC, IB
85ccf57b-f75f-57bd-ab95-82a4050ea0ff