Showing 1 - 20 results out of 126 with the query:
*
with facets:
Vendor:imported from the IEDB X
A63-B/C2 antibody
glycophorin A See NCBI gene homo sapiens
imported from the IEDB Go To Vendor
A63-B/C2
(imported from the IEDB Cat# A63-B/C2, RRID:AB_2492304)
monoclonal antibody
A63-B/C2
mus musculus balb, c
surface plasmon resonance (SPR), off rate, 1/s (0.0000292)
A63-B/C2 antibody
glycophorin A See NCBI gene homo sapiens
imported from the IEDB Go To Vendor
A63-B/C2
(imported from the IEDB Cat# A63-B/C2, RRID:AB_2492304)
monoclonal antibody
A63-B/C2
mus musculus balb, c
surface plasmon resonance (SPR), on rate, M^-1s^-1 (8260)
9D7 antibody
Interleukin-10 precursor human
imported from the IEDB Go To Vendor
9D7
(imported from the IEDB Cat# 9D7, RRID:AB_2619700)
monoclonal antibody
rat
This antibody is a heavylight chain Fab.
cAbMaz1 VHH antibody
MazE escherichia coli
imported from the IEDB Go To Vendor
cAbMaz1
(imported from the IEDB Cat# cAbMaz1, RRID:AB_2619702)
unknown
camel
This antibody is a heavyheavy chain VH Domain.
26-2F antibody
Angiogenin precursor human
imported from the IEDB Go To Vendor
26-2F
(imported from the IEDB Cat# 26-2F, RRID:AB_2619692)
monoclonal antibody
mouse balb, c
This antibody is a heavylight chain Fab.
N10 antibody
Thermonuclease precursor staphylococcus aureus
imported from the IEDB Go To Vendor
N10
(imported from the IEDB Cat# N10, RRID:AB_2619701)
monoclonal antibody
mouse balb, c
This antibody is a heavylight chain Fab.
TP7 antibody
KTLEEGRRRGYVETLFGR thermus aquaticus
imported from the IEDB Go To Vendor
TP7
(imported from the IEDB Cat# TP7, RRID:AB_2619708)
monoclonal antibody
mouse a, j
This antibody is a heavylight chain Fab.
H57 anti-TCR antibody
T-cell receptor beta-chain (V8.2D1.1J1.1C) mouse
imported from the IEDB Go To Vendor
H57 anti-TCR
(imported from the IEDB Cat# H57 anti-TCR, RRID:AB_2619709)
unknown
cricetulus migratorius
This antibody is a heavylight chain Fab.
184.1 antibody
Borrelia burgdorferi B31 borrelia burgdorferi
imported from the IEDB Go To Vendor
184.1
(imported from the IEDB Cat# 184.1, RRID:AB_2619694)
monoclonal antibody
mouse balb, c
This antibody is a heavylight chain Fab.
F9.13.7 antibody
Lysozyme C precursor chicken
imported from the IEDB Go To Vendor
F9.13.7
(imported from the IEDB Cat# F9.13.7, RRID:AB_2619689)
monoclonal antibody
mouse
This antibody is a heavylight chain Fab.
E8 antibody
Cytochrome c horse
imported from the IEDB Go To Vendor
E8
(imported from the IEDB Cat# E8, RRID:AB_2619690)
unknown
mouse balb, c
This antibody is a heavylight chain Fab.
HyHEL-10 antibody
Lysozyme C precursor chicken
imported from the IEDB Go To Vendor
HyHEL-10
(imported from the IEDB Cat# HyHEL-10, RRID:AB_2619691)
monoclonal antibody
mouse balb, c
This antibody is a heavylight chain Fv.
LA-2 antibody
Outer surface protein A borreliella burgdorferi
imported from the IEDB Go To Vendor
LA-2
(imported from the IEDB Cat# LA-2, RRID:AB_2619693)
monoclonal antibody
mouse
This antibody is a heavylight chain Fab.
UCHT1 antibody
T-cell surface glycoprotein CD3 epsilon chain precursor human
imported from the IEDB Go To Vendor
UCHT1
(imported from the IEDB Cat# UCHT1, RRID:AB_2619695)
monoclonal antibody
mouse balb, c
This antibody is a heavylight chain scFv.
Fab 12 humanized mAb A4.6.1 antibody
VEGF human
imported from the IEDB Go To Vendor
Fab 12 humanized mAb A4.6.1
(imported from the IEDB Cat# Fab 12 humanized mAb A4.6.1, RRID:AB_2619695)
monoclonal antibody
mouse
This antibody is a heavylight chain Fab.
A6 antibody
Interferon-gamma receptor alpha chain precursor human
imported from the IEDB Go To Vendor
A6
(imported from the IEDB Cat# A6, RRID:AB_2619699)
monoclonal antibody
mouse balb, c
This antibody is a heavylight chain Fab.
Jel42 antibody
Phosphocarrier protein HPr escherichia coli
imported from the IEDB Go To Vendor
Jel42
(imported from the IEDB Cat# Jel42, RRID:AB_2619703)
monoclonal antibody
mouse balb, c
This antibody is a heavylight chain Fab.
BION-1 antibody
IQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSK human
imported from the IEDB Go To Vendor
BION-1
(imported from the IEDB Cat# BION-1, RRID:AB_2619704)
monoclonal antibody
mouse balb, c
This antibody is a heavylight chain Fab.
5.11A1 antibody
T-cell-specific surface glycoprotein CD28 precursor human
imported from the IEDB Go To Vendor
5.11A1
(imported from the IEDB Cat# 5.11A1, RRID:AB_2619705)
monoclonal antibody
mouse balb, c
This antibody is a heavylight chain Fab.
10E5 antibody
Platelet from Blood (Homo sapiens) human
imported from the IEDB Go To Vendor
10E5
(imported from the IEDB Cat# 10E5, RRID:AB_2619706)
monoclonal antibody
mouse balb, c
This antibody is a heavylight chain Fab.