Showing 1 - 20 results out of 126 with the query:
*
with facets:
Vendor:imported from the IEDB X
cAbMaz1 VHH antibody
MazE escherichia coli
imported from the IEDB Go To Vendor
cAbMaz1
(imported from the IEDB Cat# cAbMaz1, RRID:AB_2619702)
unknown
camel
This antibody is a heavyheavy chain VH Domain.
6d2127e6-c0d1-5609-ba85-7fcb15c582f1
184.1 antibody
Borrelia burgdorferi B31 borrelia burgdorferi
imported from the IEDB Go To Vendor
184.1
(imported from the IEDB Cat# 184.1, RRID:AB_2619694)
monoclonal antibody
mouse balb, c
This antibody is a heavylight chain Fab.
09da0364-cba1-5292-bf62-80cb31e134d9
BION-1 antibody
IQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSK human
imported from the IEDB Go To Vendor
BION-1
(imported from the IEDB Cat# BION-1, RRID:AB_2619704)
monoclonal antibody
mouse balb, c
This antibody is a heavylight chain Fab.
7cf29719-b627-54e2-b504-b0b18d547693
Jel42 antibody
Phosphocarrier protein HPr escherichia coli
imported from the IEDB Go To Vendor
Jel42
(imported from the IEDB Cat# Jel42, RRID:AB_2619703)
monoclonal antibody
mouse balb, c
This antibody is a heavylight chain Fab.
42c6d4d0-019f-5636-be3a-08175d8abc9c
A88-E/D1 antibody
VKPLPSPDTD See NCBI gene homo sapiens
imported from the IEDB Go To Vendor
A88-E/D1
(imported from the IEDB Cat# A88-E/D1, RRID:AB_2492323)
monoclonal antibody
A88-E/D1
mus musculus balb, c
ELISA
64aca10b-4030-5e1d-82cc-a36698a453c5
A88-E/D6 antibody
VKPLPSPDTD See NCBI gene homo sapiens
imported from the IEDB Go To Vendor
A88-E/D6
(imported from the IEDB Cat# A88-E/D6, RRID:AB_2492327)
monoclonal antibody
A88-E/D6
mus musculus balb, c
ELISA
f296f7ff-3677-53be-ba74-31a3f76aa231
A88-E/D1 antibody
VKPLPSPDTD See NCBI gene homo sapiens
imported from the IEDB Go To Vendor
A88-E/D1
(imported from the IEDB Cat# A88-E/D1, RRID:AB_2492323)
monoclonal antibody
A88-E/D1
mus musculus balb, c
ELISA
80453a8b-1fb0-54ab-afad-deb893af2eaa
A88-E/D1 antibody
glycophorin A See NCBI gene homo sapiens
imported from the IEDB Go To Vendor
A88-E/D1
(imported from the IEDB Cat# A88-E/D1, RRID:AB_2492323)
monoclonal antibody
A88-E/D1
mus musculus balb, c
surface plasmon resonance (SPR), dissociation constant KD, nM (82.9)
3ae347f6-1955-5189-a4d3-a109b11e0a0e
A88-E/D1 antibody
glycophorin A See NCBI gene homo sapiens
imported from the IEDB Go To Vendor
A88-E/D1
(imported from the IEDB Cat# A88-E/D1, RRID:AB_2492323)
monoclonal antibody
A88-E/D1
mus musculus balb, c
surface plasmon resonance (SPR), association constant KA, 1/nM (0.0119)
99441719-7101-54f2-b6ce-cdbf8acd53d5
A88-D/C7 antibody
glycophorin A See NCBI gene homo sapiens
imported from the IEDB Go To Vendor
A88-D/C7
(imported from the IEDB Cat# A88-D/C7, RRID:AB_2492313)
monoclonal antibody
A88-D/C7
mus musculus balb, c
ELISA
6e698eae-9608-5371-81aa-738ff7674619
A96-E/F7 antibody
glycophorin A See NCBI gene homo sapiens
imported from the IEDB Go To Vendor
A96-E/F7
(imported from the IEDB Cat# A96-E/F7, RRID:AB_2492315)
monoclonal antibody
A96-E/F7
mus musculus balb, c
ELISA
48b43946-f43a-54f6-838a-e2b391c30287
A88-D/C7 antibody
glycophorin A See NCBI gene homo sapiens
imported from the IEDB Go To Vendor
A88-D/C7
(imported from the IEDB Cat# A88-D/C7, RRID:AB_2492313)
monoclonal antibody
A88-D/C7
mus musculus balb, c
ELISA
bb9e8746-d91c-56db-9eba-dbbb92764d84
A63-B/C2 antibody
glycophorin A See NCBI gene homo sapiens
imported from the IEDB Go To Vendor
A63-B/C2
(imported from the IEDB Cat# A63-B/C2, RRID:AB_2492304)
monoclonal antibody
A63-B/C2
mus musculus balb, c
surface plasmon resonance (SPR), off rate, 1/s (0.0000292)
415d940f-def3-58ae-9626-8522cc327382
A63-B/C2 antibody
glycophorin A See NCBI gene homo sapiens
imported from the IEDB Go To Vendor
A63-B/C2
(imported from the IEDB Cat# A63-B/C2, RRID:AB_2492304)
monoclonal antibody
A63-B/C2
mus musculus balb, c
ELISA
1afd13f3-1ce1-5e4c-b6ff-acdaa0aa836a
A83-C/B12 antibody
glycophorin A See NCBI gene homo sapiens
imported from the IEDB Go To Vendor
A83-C/B12
(imported from the IEDB Cat# A83-C/B12, RRID:AB_2492297)
monoclonal antibody
A83-C/B12
mus musculus c57bl, 6 x c3h
surface plasmon resonance (SPR), off rate, 1/s (0.000229)
f61534c7-80c8-54ff-8326-8a182fcdccc7
A83-C/B12 antibody
glycophorin A See NCBI gene homo sapiens
imported from the IEDB Go To Vendor
A83-C/B12
(imported from the IEDB Cat# A83-C/B12, RRID:AB_2492297)
monoclonal antibody
A83-C/B12
mus musculus c57bl, 6 x c3h
immuno staining
16edc80c-6160-571c-909c-69dd078396d7
A83-C/B12 antibody
glycophorin A See NCBI gene homo sapiens
imported from the IEDB Go To Vendor
A83-C/B12
(imported from the IEDB Cat# A83-C/B12, RRID:AB_2492297)
monoclonal antibody
A83-C/B12
mus musculus c57bl, 6 x c3h
surface plasmon resonance (SPR), association constant KA, 1/nM (0.0687)
c186ba32-1ae7-57c4-89e7-267b711f1a86
A96-D/A7 antibody
glycophorin A See NCBI gene homo sapiens
imported from the IEDB Go To Vendor
A96-D/A7
(imported from the IEDB Cat# A96-D/A7, RRID:AB_2492314)
monoclonal antibody
A96-D/A7
mus musculus balb, c
ELISA
4a5134dc-14b9-5b64-9c73-d0af43cb5ddb
A88-D/C7 antibody
ATPRAHEVSE See NCBI gene homo sapiens
imported from the IEDB Go To Vendor
A88-D/C7
(imported from the IEDB Cat# A88-D/C7, RRID:AB_2492313)
monoclonal antibody
A88-D/C7
mus musculus balb, c
ELISA
70e760fb-a055-53c3-bb70-526983606922
A88-E/H2 antibody
glycophorin A See NCBI gene homo sapiens
imported from the IEDB Go To Vendor
A88-E/H2
(imported from the IEDB Cat# A88-E/H2, RRID:AB_2492310)
monoclonal antibody
A88-E/H2
mus musculus balb, c
immuno staining
59b331da-412f-5ca4-9d0d-a4a8b448f37f