Showing 1 - 20 results out of 126 with the query:
*
with facets:
Vendor:imported from the IEDB X
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
26-2F antibody
Angiogenin precursor human
(imported from the IEDB Cat# 26-2F, RRID:AB_2619692)
monoclonal antibody
This antibody is a heavylight chain Fab.
mouse balb, c
imported from the IEDB Go To Vendor
26-2F
Fab-12 variant Y0317 antibody
VEGF homodimer human
(imported from the IEDB Cat# Fab-12 variant Y0317, RRID:AB_2619696)
monoclonal antibody
This antibody is a heavylight chain Fab.
mouse balb, c
imported from the IEDB Go To Vendor
Fab-12 variant Y0317
A6 antibody
Interferon-gamma receptor alpha chain precursor human
(imported from the IEDB Cat# A6, RRID:AB_2619699)
monoclonal antibody
This antibody is a heavylight chain Fab.
mouse balb, c
imported from the IEDB Go To Vendor
A6
F9.13.7 antibody
Lysozyme C precursor chicken
(imported from the IEDB Cat# F9.13.7, RRID:AB_2619689)
monoclonal antibody
This antibody is a heavylight chain Fab.
mouse
imported from the IEDB Go To Vendor
F9.13.7
UCHT1 antibody
T-cell surface glycoprotein CD3 epsilon chain precursor human
(imported from the IEDB Cat# UCHT1, RRID:AB_2619695)
monoclonal antibody
This antibody is a heavylight chain scFv.
mouse balb, c
imported from the IEDB Go To Vendor
UCHT1
A96-E/F7 antibody
glycophorin A See NCBI gene homo sapiens
(imported from the IEDB Cat# A96-E/F7, RRID:AB_2492315)
monoclonal antibody
ELISA
A96-E/F7
mus musculus balb, c
imported from the IEDB Go To Vendor
A96-E/F7
OKT3 antibody
T-cell surface glycoprotein CD3 epsilon chain precursor human
(imported from the IEDB Cat# OKT3, RRID:AB_2619696)
monoclonal antibody
This antibody is a heavylight chain Fab.
mouse balb, c
imported from the IEDB Go To Vendor
OKT3
184.1 antibody
Borrelia burgdorferi B31 borrelia burgdorferi
(imported from the IEDB Cat# 184.1, RRID:AB_2619694)
monoclonal antibody
This antibody is a heavylight chain Fab.
mouse balb, c
imported from the IEDB Go To Vendor
184.1
Jel42 antibody
Phosphocarrier protein HPr escherichia coli
(imported from the IEDB Cat# Jel42, RRID:AB_2619703)
monoclonal antibody
This antibody is a heavylight chain Fab.
mouse balb, c
imported from the IEDB Go To Vendor
Jel42
BION-1 antibody
IQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSK human
(imported from the IEDB Cat# BION-1, RRID:AB_2619704)
monoclonal antibody
This antibody is a heavylight chain Fab.
mouse balb, c
imported from the IEDB Go To Vendor
BION-1
A88-D/C7 antibody
glycophorin A See NCBI gene homo sapiens
(imported from the IEDB Cat# A88-D/C7, RRID:AB_2492313)
monoclonal antibody
ELISA
A88-D/C7
mus musculus balb, c
imported from the IEDB Go To Vendor
A88-D/C7
A88-E/D1 antibody
VKPLPSPDTD See NCBI gene homo sapiens
(imported from the IEDB Cat# A88-E/D1, RRID:AB_2492323)
monoclonal antibody
ELISA
A88-E/D1
mus musculus balb, c
imported from the IEDB Go To Vendor
A88-E/D1
A88-E/D1 antibody
glycophorin A See NCBI gene homo sapiens
(imported from the IEDB Cat# A88-E/D1, RRID:AB_2492323)
monoclonal antibody
surface plasmon resonance (SPR), dissociation constant KD, nM (82.9)
A88-E/D1
mus musculus balb, c
imported from the IEDB Go To Vendor
A88-E/D1
A88-E/D1 antibody
glycophorin A See NCBI gene homo sapiens
(imported from the IEDB Cat# A88-E/D1, RRID:AB_2492323)
monoclonal antibody
surface plasmon resonance (SPR), association constant KA, 1/nM (0.0119)
A88-E/D1
mus musculus balb, c
imported from the IEDB Go To Vendor
A88-E/D1
A96-E/F7 antibody
glycophorin A See NCBI gene homo sapiens
(imported from the IEDB Cat# A96-E/F7, RRID:AB_2492315)
monoclonal antibody
ELISA
A96-E/F7
mus musculus balb, c
imported from the IEDB Go To Vendor
A96-E/F7
A63-B/C2 antibody
glycophorin A See NCBI gene homo sapiens
(imported from the IEDB Cat# A63-B/C2, RRID:AB_2492304)
monoclonal antibody
surface plasmon resonance (SPR), off rate, 1/s (0.0000292)
A63-B/C2
mus musculus balb, c
imported from the IEDB Go To Vendor
A63-B/C2
A63-B/C2 antibody
glycophorin A See NCBI gene homo sapiens
(imported from the IEDB Cat# A63-B/C2, RRID:AB_2492304)
monoclonal antibody
surface plasmon resonance (SPR), on rate, M^-1s^-1 (8260)
A63-B/C2
mus musculus balb, c
imported from the IEDB Go To Vendor
A63-B/C2
A63-B/C2 antibody
glycophorin A See NCBI gene homo sapiens
(imported from the IEDB Cat# A63-B/C2, RRID:AB_2492304)
monoclonal antibody
ELISA
A63-B/C2
mus musculus balb, c
imported from the IEDB Go To Vendor
A63-B/C2
A83-C/B12 antibody
glycophorin A See NCBI gene homo sapiens
(imported from the IEDB Cat# A83-C/B12, RRID:AB_2492297)
monoclonal antibody
surface plasmon resonance (SPR), off rate, 1/s (0.000229)
A83-C/B12
mus musculus c57bl, 6 x c3h
imported from the IEDB Go To Vendor
A83-C/B12
A83-C/B12 antibody
glycophorin A See NCBI gene homo sapiens
(imported from the IEDB Cat# A83-C/B12, RRID:AB_2492297)
monoclonal antibody
immuno staining
A83-C/B12
mus musculus c57bl, 6 x c3h
imported from the IEDB Go To Vendor
A83-C/B12