Validation for COVID-19 Related Antibodies


US6

RRID
Clone
Epitope
Source

Surface Glycoprotein

RRID
Clone
Epitope
Source
CR3022
Y369, N370, S371, A372, F374, F377, K378, C379, Y3...

Spike Protein

RRID
Clone
Epitope
Source
AM004414
Active Motif - Validation provided by Dr. Cyril Peter, data provided by M.Iskhakova, Akbarian Lab, Icahn School of Medicine (psyENCODE)
AM006415
Active Motif - Validation provided by Dr. Cyril Peter, data provided by M.Iskhakova, Akbarian Lab, Icahn School of Medicine (psyENCODE)
5000000000000
HDFVADMYQLAQ; LMQINPTYYQIM; MQYVYTPTYYML; WSFNPSTYTIAG
MAb 57.57
CYTVSDSSFFSYGEIPFGVTDGPRY; DVLNKN; KVNDA; NNSNDL; QLAKDKVNE; SFFSYGEI; VANADK; VNNKN
1AF10
K540, R541, S542, G543, Y544, G545, Q546, I548, L5...; KRSGYGQPIA
CR3022
Abcam - Validation provided by Dr. Cyril Peter, data provided by M.Iskhakova, Akbarian Lab, Icahn School of Medicine (psyENCODE)

Spike Glycoprotein S

RRID
Clone
Epitope
Source
S1
SNVYADSFVVKGDDVRQIAP; VYAWERKKISNCVADYSVLYNSTF

Spike Glycoprotein Receptor Binding Domain

RRID
Clone
Epitope
Source

Spike Glycoprotein Precursor

RRID
Clone
Epitope
Source
5B19.2
LLGCIGSTC; SPLLGCIGSTCA; SPLLGCIGSTCAE
1
SPDVDLGDASGINAS; SPDVDLGDISAINAS; SPDVDLGDISGINAS
5
SPDVDLGDASGINAS; SPDVDLGDISAINAS; SPDVDLGDISGINAS
7
SPDVDLGDASGINAS; SPDVDLGDISAINAS; SPDVDLGDISGINAS
8
SPDVDLGDASGINAS; SPDVDLGDISAINAS; SPDVDLGDISGINAS
400000
ALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFEL
30000000000
ALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFEL
N-176-15
K343, K344, I345, S346, N347, C348, V349, A350, D3...
S-9-11
K343, K344, I345, S346, N347, C348, V349, A350, D3...

Spike Glycoprotein [Human betacoronavirus 2c EMC/2012]

RRID
Clone
Epitope
Source
4C2
Y397, N398, K400, L495, K496, P525, V527, S528, I529, V530, P531, S532, W535, E536, D539, Y540, Y541, R542, K543, Q544
7D10
Y18, D20, P23, D24, V26, K27, S28, E188, S191, N226, L234, R235, N236
CDC2-C2
N501, K502, S504, F506, D510, R511, T512, E513, W535, E536, D537, G538, D539, Y540, Y541, R542, W553, V555, A556, S557
D12
G391, T392, P394, Y397, N398, F399, K400, L495, K496, P525, V527, S528, I529, V530, P531, S532, T533, W535, E536, D537, D539, Y540, Y541, R542, K543, Q544, L545, S546, E549, W553, T560
G2
V26, K27, S28, A29, T96, P97, S157, S191, G192, N193, A197, G198, N199, T209, R301
G4
Y777, V1149, V1150, K1174, T1175, N1176, N1177, T1178, R1179, I1180, V1181, E1183, W1184, P1196, Q1212, S1215, N1217
JC57-14
P394, Y397, N398, F399, K400, Y523, V527, S528, I529, V530, P531, S532, W535, E536, D539, Y540, Y541, R542, K543, Q544, L545, S546, P547, L548, E549, W553
m336
N501, K502, S504, F506, D510, E513, P531, W535, E536, D537, G538, D539, Y540, Y541, R542, W553, V555, S557, G558, S559
MCA1
D510, I529, P531, W535, E536, D539, Y540, Y541, R542, K543, Q544, W553
MERS-27
V527, S528, I529, V530, P531, S532, W535, E536, D539, Y540, Y541, R542
MERS-4V2
R242, L244, S245, V251, Q253, N256, A257, Q259, Y260, P262, K280, L282, S283, P284, L285, E286, G287, L291

Spike Glycoprotein

RRID
Clone
Epitope
Source
Abcam - Validation provided by Dr. Cyril Peter, data provided by M.Iskhakova, Akbarian Lab, Icahn School of Medicine (psyENCODE)
H6
Abcam - Validation provided by Dr. Cyril Peter, data provided by M.Iskhakova, Akbarian Lab, Icahn School of Medicine (psyENCODE)
1BB1
G543, G545, L586, W587, D588, T647, N648
1G10
ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYI
0219-10-28
LYQDVNCTDVSTAIHADQLTPAWRIYSTG
2B2
FFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSF
6AC3
G543, Y544, G545, L586, D588, T647, N648
80R
R426, S432, T433, Y436, N437, K439, Y440, Y442, P469, P470, A471, L472, N473, C474, Y475, W476, L478, N479, D480, Y481, G482, Y484, T485, T486, T487, G488, I489, Y491, Q492
CR3006
K344, F360, Y442, L472, D480, T487
E10E-1-10
VSGFWTIASTNFVDALIEVQGTAIQRILYCDDPVSQLKCSQVAFDLDDGFY
m396
T359, T363, K365, K390, G391, D392, R395, R426, Y436, G482, Y484, T485, T486, T487, G488, I489, G490, Y491, Q492, Y494
MERS-4
D455, E513, R542; R242, L244, S245, D246, N256, N258, Q259, Y260, S2...
492-1G10E4E2
TKPLKYSYINKCSRFLSDDRTEVPQ; TKPLKYSYINKCSRLLSDDRTEVPQ
506-2G10G5
TKPLKYSYINKCSRFLSDDRTEVPQ; TKPLKYSYINKCSRLLSDDRTEVPQ
F26G19
T359, S362, G391, D392, N424, R426, N427, T486, T4...; TTGIGYQ

S Protein

RRID
Clone
Epitope
Source
LCA60
K493, L495, K496, I529, P531, S532, T533, W535, E5...; T489, K493, E536, E565
2000000
Y397, N398, K400, L495, K496, P525, V527, S528, I5...

Replicase Polyprotein 1ab

RRID
Clone
Epitope
Source

Putative Coronavirus nsp9 (RdRp)

RRID
Clone
Epitope
Source

Nucleoprotein

RRID
Clone
Epitope
Source
6D11C1
N286, F287, G288, D289, Q290, D291, L292, I293, R294, Q295, G296, T297, D298, F316, G317, M318, S319, R320, I321, G322, M323, E324, V325, I358, D359, A360, Y361, K362, T363, F364, P365, P366, T367, E368, P369, K370

Nucleocapsid Protein

RRID
Clone
Epitope
Source
1G7D1
A274, F275, G276, R277, R278, G279, P280, E281, Q2...
2G8D4
A274, F275, G276, R277, R278, G279, P280, E281, Q2...

Membrane Protein

RRID
Clone
Epitope
Source

Furin

RRID
Clone
Epitope
Source
EPR14674
Abcam - Validation provided by Dr. Cyril Peter, data provided by M.Iskhakova, Akbarian Lab, Icahn School of Medicine (psyENCODE)

CD147

RRID
Clone
Epitope
Source
[MEM-M6/1]
Abcam - Validation provided by Dr. Cyril Peter, data provided by M.Iskhakova, Akbarian Lab, Icahn School of Medicine (psyENCODE)