Showing 1 - 2 results out of 2 with the query:
AB_10598912
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-PPP2R5D antibody produced in rabbit
PPP2R5D antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA029045, RRID:AB_10598912)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot
rabbit
Sigma-Aldrich
HPA029045
Anti-PPP2R5D antibody Go To Vendor
PPP2R5D epitope: DCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVY See NCBI gene human, mouse, rat
(Atlas Antibodies Cat# HPA029045, RRID:AB_10598912)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA029045