Showing 1 - 2 results out of 2 with the query:
AB_10598915
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-SASH1 antibody produced in rabbit
SASH1 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA029947, RRID:AB_10598915)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other
rabbit
Sigma-Aldrich
HPA029947
Anti-SASH1 polyclonal antibody Go To Vendor
SASH1 epitope: LLSAKSSTEPSLKSFSRNQLGNYPTLPLMKSGDALKQGQEEGRLGGGLAPDTSKSCDPPGVTGLNKNRRSLPVSICRSCETLEGPQTVDTWPRSH See NCBI gene human
(Atlas Antibodies Cat# HPA029947, RRID:AB_10598915)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA029947