Showing 1 - 2 results out of 2 with the query:
AB_10601446
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-SPP1 antibody produced in rabbit
SPP1 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA027541, RRID:AB_10601446)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA027541
Anti-SPP1 antibody
SPP1 epitope: SQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDAT See NCBI gene human
(Atlas Antibodies Cat# HPA027541, RRID:AB_10601446)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA027541