Showing 1 - 2 results out of 2 with the query:
AB_10601795
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-CCDC18 antibody produced in rabbit
CCDC18 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA028035, RRID:AB_10601795)
polyclonal antibody
Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
rabbit
Sigma-Aldrich
HPA028035
Anti-CCDC18 polyclonal antibody
CCDC18 epitope: HQVESVKDQNQHTMNKQYEKERQRLVTGIEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKLESEMTKKCSQLLTLEKQLEEKI See NCBI gene human
(Atlas Antibodies Cat# HPA028035, RRID:AB_10601795)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA028035