Showing 1 - 2 results out of 2 with the query:
AB_10601858
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-TJAP1 antibody produced in rabbit
TJAP1 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA030166, RRID:AB_10601858)
polyclonal antibody
Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA030166
Anti-TJAP1 polyclonal antibody Go To Vendor
TJAP1 epitope: RLDCNLAVQLLKCNKSHFRNHKFADLPCELQDMVRKHLHSGQEAASPGPAPSLAPGAVVPTSVIARVLEKPESLLLNSAQS See NCBI gene human
(Atlas Antibodies Cat# HPA030166, RRID:AB_10601858)
polyclonal antibody
Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies
HPA030166