Showing 1 - 2 results out of 2 with the query:
AB_10601874
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-MLLT1 antibody produced in rabbit
MLLT1 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA031166, RRID:AB_10601874)
polyclonal antibody
Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
rabbit
Sigma-Aldrich
HPA031166
Anti-MLLT1 polyclonal antibody
MLLT1 epitope: MVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKTKPSHGSKDANKESSKTSKPHKVTKEHRERPRKDSESKSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPPPKAAFKEPKMALKE See NCBI gene human
(Atlas Antibodies Cat# HPA031166, RRID:AB_10601874)
polyclonal antibody
Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
rabbit
Atlas Antibodies Go To Vendor
HPA031166