Showing 1 - 2 results out of 2 with the query:
AB_10601928
Note: If possible, search using a catalog number. Avoid using “llc”, “inc”, or any other abbreviation at the end of your search.
Antibody ID
Antibody Name
Target Antigen
Proper Citation
Reference
Comments
Clone ID
Host Organism
Vendor
Cat Num
Anti-ZMYND10 antibody produced in rabbit
ZMYND10 antibody produced in rabbit human
(Sigma-Aldrich Cat# HPA035255, RRID:AB_10601928)
polyclonal antibody
Vendor recommendations: Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
rabbit
Sigma-Aldrich
HPA035255
Anti-ZMYND10 polyclonal antibody
ZMYND10 epitope: MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPTLVEELIAVEMWKQKVFPVFCRVEDFKPQNT See NCBI gene human
(Atlas Antibodies Cat# HPA035255, RRID:AB_10601928)
polyclonal antibody
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPTLVEELIAVEMWKQKVFPVFCRVEDFKPQNT; Manufacturer approved use: ICC-IF, IHC
rabbit
Atlas Antibodies Go To Vendor
HPA035255